StarFunc result for job id Q86UP2

User Input

>input (1357 residues)
MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKK
KNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPVPLNVVETSSSVRERKKKEKK
QKPVLEEQVIKESDASKIPGKKVEPVPVTKQPTPPSEAAASKKKPGQKKSKNGSDDQDKK
VETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNA
DSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDE
ALCVVDLLKEKSGVIQDALKKSSKGELTTLIHQLQEKDKLLAAVKEDAAATKDRCKQLTQ
EMMTEKERSNVVITRMKDRIGTLEKEHNVFQNKIHVSYQETQQMQMKFQQVREQMEAEIA
HLKQENGILRDAVSNTTNQLESKQSAELNKLRQDYARLVNELTEKTGKLQQEEVQKKNAE
QAATQLKVQLQEAERRWEEVQSYIRKRTAEHEAAQQDLQSKFVAKENEVQSLHSKLTDTL
VSKQQLEQRLMQLMESEQKRVNKEESLQMQVQDILEQNEALKAQIQQFHSQIAAQTSASV
LAEELHKVIAEKDKQIKQTEDSLASERDRLTSKEEELKDIQNMNFLLKAEVQKLQALANE
QAAAAHELEKMQQSVYVKDDKIRLLEEQLQHEISNKMEEFKILNDQNKALKSEVQKLQTL
VSEQPNKDVVEQMEKCIQEKDEKLKTVEELLETGLIQVATKEEELNAIRTENSSLTKEVQ
DLKAKQNDQVSFASLVEELKKVIHEKDGKIKSVEELLEAELLKVANKEKTVQDLKQEIKA
LKEEIGNVQLEKAQQLSITSKVQELQNLLKGKEEQMNTMKAVLEEKEKDLANTGKWLQDL
QEENESLKAHVQEVAQHNLKEASSASQFEELEIVLKEKENELKRLEAMLKERESDLSSKT
QLLQDVQDENKLFKSQIEQLKQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKD
AVEHQRKKNNDLREKNWEAMEALASTEKMLQDKVNKTSKERQQQVEAVELEAKEVLKKLF
PKVSVPSNLSYGEWLHGFEKKAKECMAGTSGSEEVKVLEHKLKEADEMHTLLQLECEKYK
SVLAETEGILQKLQRSVEQEENKWKVKVDESHKTIKQMQSSFTSSEQELERLRSENKDIE
NLRREREHLEMELEKAEMERSTYVTEVRELKDLLTELQKKLDDSYSEAVRQNEELNLLKA
QLNETLTKLRTEQNERQKVAGDLHKAQQSLELIQSKIVKAAGDTTVIENSDVSPETESSE
KETMSVSLNQTVTQLQQLLQAVNQQLTKEKEHYQVLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61595	0.278	0.283	0.000	1327	0.808	0.827	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
2	AFDB:Q86UP2	1.000	1.000	0.000	1357	1.000	1.000	Q86UP2.pdb.gz	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1
3	AFDB:F1P0K1	0.096	0.127	2.251E-18	997	0.239	0.325	F1P0K1.pdb.gz
4	AFDB:Q9UPS8	0.075	0.061	1.476E-9	1710	0.175	0.139	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
5	AFDB:Q9VEH0	0.071	0.112	3.449E-9	842	0.083	0.133	Q9VEH0.pdb.gz	Q9VEH0_DROME Aluminum tubes, isoform A OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
6	AFDB:Q960Y8	0.057	0.084	3.930E-9	874	0.101	0.157	Q960Y8.pdb.gz	Q960Y8_DROME Aluminum tubes, isoform G OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
7	AFDB:E7F5E1	0.064	0.063	1.171E-7	1367	0.147	0.146	E7F5E1.pdb.gz	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
8	AFDB:A0A024R370	0.057	0.066	1.520E-7	1093	0.131	0.163	A0A024R370.pdb.gz
9	AFDB:Q811D2	0.107	0.094	1.849E-7	1581	0.158	0.135	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
10	AFDB:B9EK46	0.076	0.084	2.401E-7	1203	0.136	0.154	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
11	PDB:5svaS	0.046	0.351	5.715E-1	109	0.013	0.156	5svaS.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:2zdiB	0.045	0.313	1.521	106	0.010	0.132	2zdiB.pdb.gz
13	PDB:1u2mC	0.051	0.398	1.624	143	0.008	0.077	1u2mC.pdb.gz
14	PDB:3ajwA	0.049	0.410	1.850	134	0.012	0.119	3ajwA.pdb.gz
15	PDB:4gwpD	0.046	0.326	2.403	121	0.013	0.140	4gwpD.pdb.gz
16	PDB:6so5C	0.047	0.401	2.403	144	0.010	0.090	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
17	PDB:1wleB	0.046	0.127	2.922	469	0.007	0.019	1wleB.pdb.gz	Dual-mode recognition of noncanonical tRNAs(Ser) by seryl-tRNA synthetase in mammalian mitochondria
18	PDB:6wczA	0.051	0.183	3.119	350	0.008	0.031	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
19	PDB:7lbmn	0.043	0.197	3.330	283	0.001	0.007	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
20	PDB:7q83D	0.048	0.395	3.330	156	0.005	0.045	7q83D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61595	0.0	2008	1327	0.805	0.823	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
2	Q86UP2	0.0	2693	1357	1.000	1.000	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1
3	F1M853	8.06e-46	183	1453	0.116	0.108	F1M853_RAT Ribosome binding protein 1 OS=Rattus norvegicus OX=10116 GN=Rrbp1 PE=1 SV=3
4	Q99PL5	3.42e-45	181	1605	0.116	0.098	RRBP1_MOUSE Ribosome-binding protein 1 OS=Mus musculus OX=10090 GN=Rrbp1 PE=1 SV=2
5	F8W7S5	4.69e-42	168	751	0.100	0.181	F8W7S5_HUMAN Ribosome binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=1
6	Q9P2E9	1.59e-40	166	1410	0.101	0.097	RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5
7	Q28298	2.42e-40	166	1534	0.119	0.105	RRBP1_CANLF Ribosome-binding protein 1 OS=Canis lupus familiaris OX=9615 GN=RRBP1 PE=2 SV=1
8	Q07718	3.24e-34	144	725	0.079	0.148	Q07718_CHICK ES/130 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
9	A0A087WU26	7.50e-29	121	346	0.074	0.289	A0A087WU26_HUMAN Ribosome binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=1
10	G3V599	0.006	43.5	1339	0.060	0.061	G3V599_HUMAN MIA SH3 domain ER export factor 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=1
11	Q96PC5	0.007	43.5	1412	0.060	0.058	MIA2_HUMAN Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4
12	Q99323	0.13	39.3	2057	0.089	0.059	MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster OX=7227 GN=zip PE=1 SV=2
13	Q5VU43	0.16	38.9	2346	0.069	0.040	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
14	H2L0I2	0.55	37.4	2396	0.064	0.036	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
15	H2L0I4	0.60	37.0	2392	0.064	0.036	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
16	H2L0I3	0.63	37.0	2323	0.064	0.037	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
17	F1QNW4	0.88	36.2	475	0.045	0.128	DRC4_DANRE Dynein regulatory complex subunit 4 OS=Danio rerio OX=7955 GN=gas8 PE=2 SV=1
18	P32380	1.6	35.8	944	0.105	0.151	SP110_YEAST Spindle pole body component 110 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC110 PE=1 SV=1
19	M9MRJ4	1.8	35.8	13540	0.032	0.003	M9MRJ4_DROME Muscle-specific protein 300 kDa, isoform G OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
20	P0CK98	2.5	35.0	947	0.045	0.064	CCD39_DANRE Coiled-coil domain-containing protein 39 OS=Danio rerio OX=7955 GN=ccdc39 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05104 Rib_recp_KP_reg	2.3e-19	82.4	Ribosome receptor lysine/proline rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378725

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410059	0.941	Elongation factor 1-delta
2	9606.ENSP00000400175	0.905	Transforming protein RhoA
3	9606.ENSP00000339467	0.838	Rho-related GTP-binding protein RhoG
4	9606.ENSP00000307078	0.805	Kinesin-1 heavy chain
5	9606.ENSP00000331901	0.772	Elongation factor 1-gamma
6	9606.ENSP00000383118	0.719	Cell division control protein 42 homolog
7	9606.ENSP00000359664	0.708	Di-N-acetylchitobiase
8	9606.ENSP00000414982	0.697	Kinesin light chain 1
9	9606.ENSP00000227756	0.679	Polypeptide N-acetylgalactosaminyltransferase 18
10	9606.ENSP00000344260	0.662	Polypeptide N-acetylgalactosaminyltransferase 15
11	9606.ENSP00000348461	0.662	Ras-related C3 botulinum toxin substrate 1
12	9606.ENSP00000367265	0.660	Cytoskeleton-associated protein 4
13	9606.ENSP00000376056	0.657	Elongation factor 1-beta
14	9606.ENSP00000380855	0.640	Programmed cell death 1 ligand 2
15	9606.ENSP00000280734	0.637	Lysoplasmalogenase-like protein TMEM86A
16	9606.ENSP00000411831	0.632	Kinesin-like protein KIF21B
17	9606.ENSP00000408979	0.621	Kinesin heavy chain isoform 5A
18	9606.ENSP00000314380	0.612	Protein lifeguard 1
19	9606.ENSP00000236273	0.611	Pre-mRNA-splicing factor SYF2
20	9606.ENSP00000255266	0.602	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	0.997	cadherin binding
GO:0003723	0.997	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0007017	0.944	microtubule-based process
GO:0007018	0.825	microtubule-based movement
GO:0050789	0.406	regulation of biological process
GO:0050794	0.340	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0070013	0.994	intracellular organelle lumen
GO:0016020	0.991	membrane
GO:0071944	0.981	cell periphery
GO:0031090	0.946	organelle membrane
GO:0005886	0.930	plasma membrane
GO:0005829	0.773	cytosol
GO:0031984	0.753	organelle subcompartment
GO:0098827	0.700	endoplasmic reticulum subcompartment
GO:0042175	0.666	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.658	endoplasmic reticulum membrane
GO:0031981	0.560	nuclear lumen
GO:0005654	0.401	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]