StarFunc result for job id Q86UP3

User Input

>input (1400 residues)
METCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEA
LLGFSVENAAATQVTSAKEIPCNECATSFPSLQKYMEHHCPNARLPVLKDDNESEISELE
DSDVENLTGEIVYQPDGSAYIIEDSKESGQNAQTGANSKLFSTAMFLDSLASAGEKSDQS
ASAPMSFYPQIINTFHIASSLGKPFTADQAFPNTSALAGVGPVLHSFRVYDLRHKREKDY
LTSDGSAKNSCVSKDVPNNVDLSKFDGCVSDGKRKPVLMCFLCKLSFGYIRSFVTHAVHD
HRMTLNDEEQKLLSNKCVSAIIQGIGKDKEPLISFLEPKKSTSVYPHFSTTNLIGPDPTF
RGLWSAFHVENGDSLPAGFAFLKGSASTSSSAEQPLGITQMPKAEVNLGGLSSLVVNTPI
TSVSLSHSSSESSKMSESKDQENNCERPKESNVLHPNGECPVKSEPTEPGDEDEEDAYSN
ELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTEKKKQTA
AVRASGSVASNYGISGKDFADASASKDSATAAHPSEIARGDEDSSATPHQHGFTPSTPGT
PGPGGDGSPGSGIECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLE
AHMKEKHPEPGGSCVYCKTGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQS
DKHLNNVQNLQNGNGEQVFGHSAPAPNTSLSGCGTPSPSKPKQKPTWRCEVCDYETNVAR
NLRIHMTSEKHMHNMMLLQQNMKQIQHNLHLGLAPAEAELYQYYLAQNIGLTGMKLENPA
DPQLMINPFQLDPATAAALAPGLGELSPYISDPALKLFQCAVCNKFTSDSLEALSVHVSS
ERSLPEEEWRAVIGDIYQCKLCNYNTQLKANFQLHCKTDKHMQKYQLVAHIKEGGKSNEW
RLKCIAIGNPVHLKCNACDYYTNSVDKLRLHTTNHRHEAALKLYKHLQKQEGAVNPESCY
YYCAVCDYTTKVKLNLVQHVRSVKHQQTEGLRKLQLHQQGLAPEEDNLSEIFFVKDCPPN
ELETASLGARTCDDDLTEQHEEAEGAIKPTAVAEDDEKDTSERDNSEGKNSNKDSVSVAG
GTQPLLLAKEEDVATKRSKPTEDNKFCHEQFYQCPYCNYNSRDQSRIQMHVLSQHSVQPV
ICCPLCQDVLSNKMHLQLHLTHLHSVSPDCVEKLLMTVPVPDVMMPNSMLLPAAASEKSE
RDTPAAVTAEGSGKYSGESPMDDKSMAGLEDSKANVEVKNEEQKPTKEPLEVSEWNKNSS
KDVKIPDTLQDQLNEQQKRQPLSVSDRHVYKYRCNHCSLAFKTMQKLQIHSQYHAIRAAT
MCNLCQRSFRTFQALKKHLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCE3	0.065	0.069	6.928E-11	1301	0.144	0.155	Q9HCE3.pdb.gz	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
2	AFDB:Q9VY72	0.040	0.037	1.650E-6	1553	0.140	0.126	Q9VY72.pdb.gz	Q9VY72_DROME Maternal gene required for meiosis, isoform H OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=4
3	AFDB:Q9VED3	0.034	0.039	5.453E-6	1186	0.134	0.159	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
4	AFDB:A2A7B5	0.049	0.044	1.520E-5	1709	0.146	0.120	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
5	AFDB:Q5BIH1	0.042	0.062	1.609E-5	803	0.084	0.146	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
6	AFDB:Q96PN7	0.045	0.050	2.537E-5	1200	0.126	0.147	Q96PN7.pdb.gz	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
7	AFDB:A0A0K3AUE4	0.036	0.032	3.570E-5	1968	0.153	0.109	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
8	AFDB:Q9SZQ2	0.032	0.035	1.053E-4	1211	0.123	0.142	Q9SZQ2.pdb.gz	Q9SZQ2_ARATH AT4g29790/F27B13_30 OS=Arabidopsis thaliana OX=3702 GN=At4g29790 PE=1 SV=1
9	AFDB:Q8BZ47	0.037	0.037	1.569E-4	1413	0.142	0.141	Q8BZ47.pdb.gz	ZN609_MOUSE Zinc finger protein 609 OS=Mus musculus OX=10090 GN=Znf609 PE=1 SV=2
10	AFDB:Q5EXX3	0.041	0.045	1.758E-4	1203	0.116	0.135	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
11	PDB:3w5kB	0.027	0.191	2.931E-1	110	0.014	0.173	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6qx91C	0.025	0.558	1.528	50	0.007	0.200	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:5gm6I	0.030	0.293	1.813	102	0.009	0.118	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:5z56v	0.029	0.217	1.919	167	0.008	0.066	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:5zwmv	0.028	0.203	1.919	174	0.016	0.132	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
16	PDB:7dvqv	0.029	0.273	2.410	119	0.011	0.126	7dvqv.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:5vvrJ	0.022	0.316	2.700	70	0.006	0.129	5vvrJ.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
18	PDB:3cmuA	0.031	0.022	3.800	1937	0.010	0.007	3cmuA.pdb.gz	Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures.
19	PDB:7uliAAA	0.020	0.060	4.023	377	0.008	0.029	7uliAAA.pdb.gz
20	PDB:7pt6I	0.024	0.085	5.051	341	0.014	0.056	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M4Q6	0.0	1446	3730	0.586	0.220	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
2	Q15911	0.0	1470	3703	0.585	0.221	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
3	Q61329	0.0	1436	3726	0.583	0.219	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
4	Q9JJN2	0.0	2534	3550	0.914	0.360	ZFHX4_MOUSE Zinc finger homeobox protein 4 OS=Mus musculus OX=10090 GN=Zfhx4 PE=1 SV=1
5	Q2MHN3	1.52e-147	500	2562	0.205	0.112	ZFHX2_MOUSE Zinc finger homeobox protein 2 OS=Mus musculus OX=10090 GN=Zfhx2 PE=1 SV=1
6	Q9C0A1	1.62e-139	476	2572	0.196	0.107	ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=3
7	P28167	2.31e-66	251	3005	0.090	0.042	ZFH2_DROME Zinc finger protein 2 OS=Drosophila melanogaster OX=7227 GN=zfh2 PE=1 SV=2
8	Q8NCP5	5.09e-05	50.1	570	0.048	0.118	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
9	Q9NTW7	5.59e-05	50.1	645	0.056	0.121	ZF64B_HUMAN Zinc finger protein 64 OS=Homo sapiens OX=9606 GN=ZFP64 PE=1 SV=3
10	Q99KE8	6.85e-05	49.7	643	0.054	0.117	ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus OX=10090 GN=Zfp64 PE=1 SV=1
11	P08048	1.37e-04	48.9	801	0.037	0.065	ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFY PE=1 SV=3
12	P17010	1.48e-04	48.9	805	0.037	0.065	ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX PE=2 SV=2
13	E9PEP7	1.93e-04	48.5	755	0.037	0.069	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
14	Q9W0P9	2.60e-04	47.8	442	0.023	0.072	Q9W0P9_DROME Kahuli OS=Drosophila melanogaster OX=7227 GN=Kah PE=2 SV=1
15	Q7TS63	2.72e-04	48.1	1237	0.036	0.040	ZFAT_MOUSE Zinc finger protein ZFAT OS=Mus musculus OX=10090 GN=Zfat PE=1 SV=2
16	P17012	3.19e-04	47.8	799	0.021	0.038	ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus OX=10090 GN=Zfx PE=1 SV=2
17	Q9N360	4.25e-04	47.4	662	0.025	0.053	Q9N360_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=znf-782 PE=1 SV=1
18	E7FAN3	5.81e-04	47.0	764	0.028	0.051	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
19	Q9Y330	6.31e-04	46.6	459	0.024	0.074	ZBT12_HUMAN Zinc finger and BTB domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZBTB12 PE=1 SV=1
20	D2KMS9	0.001	46.2	1009	0.023	0.032	D2KMS9_DANRE Rumba zinc finger protein OS=Danio rerio OX=7955 GN=si:ch211-87d12.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09237 GAGA	2.4e+02	13.2	GAGA factor
2	PF16559 GIT_CC	4.3e+02	12.1	GIT coiled-coil Rho guanine nucleotide exchange factor
3	PF01803 LIM_bind	4.9e+02	11.6	LIM-domain binding protein
4	PF00096 zf-C2H2	2.3e-05	35.7	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	0.15	23.7	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	9e-07	40.2	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	67	14.9	C2H2-type zinc finger
8	PF05605 zf-Di19	0.073	24.7	Drought induced 19 protein (Di19), zinc-binding
9	PF13909 zf-H2C2_5	8.7e-07	39.9	C2H2-type zinc-finger domain
10	PF12874 zf-met	0.55	21.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000039624

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000039322	0.750	Chromodomain helicase DNA binding protein 4
2	9598.ENSPTRP00000029372	0.702	Proline rich 16
3	9598.ENSPTRP00000019407	0.695	Uncharacterized protein
4	9598.ENSPTRP00000047348	0.695	Protocadherin 19
5	9598.ENSPTRP00000037997	0.693	Tetraspanin 6
6	9598.ENSPTRP00000047411	0.688	Chromosome X open reading frame 67
7	9598.ENSPTRP00000047558	0.677	Uncharacterized protein
8	9598.ENSPTRP00000000614	0.669	Runt-related transcription factor
9	9598.ENSPTRP00000015465	0.667	Polycomb group ring finger 2
10	9598.ENSPTRP00000011068	0.603	Paraneoplastic antigen MA1
11	9598.ENSPTRP00000008559	0.600	Homeobox C8
12	9598.ENSPTRP00000029923	0.591	Lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
13	9598.ENSPTRP00000034651	0.584	Snail family transcriptional repressor 2
14	9598.ENSPTRP00000028092	0.570	Uncharacterized protein
15	9598.ENSPTRP00000057177	0.567	Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
16	9598.ENSPTRP00000035234	0.559	Uncharacterized protein
17	9598.ENSPTRP00000025093	0.542	Acrosin
18	9598.ENSPTRP00000028663	0.542	Uncharacterized protein
19	9598.ENSPTRP00000047128	0.502	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.755	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.714	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.951	biological regulation
GO:0050789	0.942	regulation of biological process
GO:0050794	0.886	regulation of cellular process
GO:0019222	0.497	regulation of metabolic process
GO:0060255	0.488	regulation of macromolecule metabolic process
GO:0051171	0.488	regulation of nitrogen compound metabolic process
GO:0080090	0.481	regulation of primary metabolic process
GO:0031323	0.481	regulation of cellular metabolic process
GO:0010468	0.478	regulation of gene expression
GO:0006355	0.420	regulation of DNA-templated transcription
GO:0048518	0.322	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.419	cytoplasm
GO:0070013	0.386	intracellular organelle lumen
GO:0031981	0.383	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]