StarFunc result for job id Q86UP8

User Input

>input (949 residues)
MAQVAVSTLPVEEESSSETRMVVTFLVSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGCAFVNARTDFQKDFAKYCVAEGLCEVKPPCPVNGMQVHSGETEILRKAVEDYFCFCYG
KALGTTVMVPVPYEKMLRDQSAVVVQGLPEGVAFQHPENYDLATLKWILENKAGISFIIN
RPFLGPESQLGGPGMVTDAERSIVSPSESCGPINVKTEPMEDSGISLKAEAVSVKKESED
PNYYQYNMQGSHPSSTSNEVIEMELPMEDSTPLVPSEEPNEDPEAEVKIEGNTNSSSVTN
SAAGVEDLNIVQVTVPDNEKERLSSIEKIKQLREQVNDLFSRKFGEAIGVDFPVKVPYRK
ITFNPGCVVIDGMPPGVVFKAPGYLEISSMRRILEAAEFIKFTVIRPLPGLELSNVGKRK
IDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYMER
MRDEKLHELKKGLRKYLLGSSDTECPEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREK
IRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVE
KSLKNFCIDWSKLVSVASTGTPAMVDANNGLVTKLKSRVATFCKGAELKSICCIIHPESL
CAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVL
KRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQM
YDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGLNYIPKIAELQTEFQKRLSDF
KLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK
YKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99NI3	0.511	0.518	0.000	936	0.787	0.798	Q99NI3.pdb.gz	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
2	AFDB:X5DNP5	0.113	0.110	6.650E-32	978	0.296	0.287	X5DNP5.pdb.gz	X5DNP5_HUMAN General transcription factor IIi isoform B (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
3	AFDB:X5D2J9	0.124	0.123	2.068E-31	957	0.287	0.284	X5D2J9.pdb.gz	X5D2J9_HUMAN General transcription factor IIi isoform D (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
4	AFDB:A0A494C1K3	0.110	0.093	4.898E-31	1159	0.295	0.242	A0A494C1K3.pdb.gz	A0A494C1K3_HUMAN General transcription factor IIi OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=1
5	AFDB:Q8VEH5	0.377	0.565	3.223E-28	606	0.151	0.236	Q8VEH5.pdb.gz	EPMIP_MOUSE EPM2A-interacting protein 1 OS=Mus musculus OX=10090 GN=Epm2aip1 PE=1 SV=1
6	AFDB:Q7L775	0.379	0.567	5.556E-28	607	0.159	0.249	Q7L775.pdb.gz	EPMIP_HUMAN EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1
7	AFDB:Q9JI57	0.123	0.109	1.247E-20	1104	0.150	0.129	Q9JI57.pdb.gz	GT2D1_MOUSE General transcription factor II-I repeat domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gtf2ird1 PE=2 SV=2
8	AFDB:B7ZQJ9	0.126	0.121	1.018E-18	993	0.142	0.136	B7ZQJ9.pdb.gz	GT2D1_XENLA General transcription factor II-I repeat domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gtf2ird1 PE=1 SV=1
9	AFDB:Q9M2N5	0.276	0.360	8.042E-12	696	0.086	0.118	Q9M2N5.pdb.gz	DSLE_ARATH Zinc finger BED domain-containing protein DAYSLEEPER OS=Arabidopsis thaliana OX=3702 GN=HAT PE=1 SV=1
10	AFDB:O08815	0.057	0.048	3.045E-2	1206	0.102	0.080	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
11	PDB:2ivnA	0.092	0.185	1.429E-1	325	0.032	0.092	2ivnA.pdb.gz	An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro.
12	PDB:6z81A	0.075	0.167	1.637E-1	342	0.022	0.061	6z81A.pdb.gz	Structure of a reaction intermediate mimic in t6A biosynthesis bound in the active site of the TsaBD heterodimer from Escherichia coli.
13	PDB:3v9xB	0.057	0.156	2.697E-1	212	0.023	0.104	3v9xB.pdb.gz	How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
14	PDB:4yduC	0.071	0.230	2.697E-1	230	0.020	0.083	4yduC.pdb.gz	The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
15	PDB:5fpnA	0.074	0.158	3.090E-1	379	0.023	0.058	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
16	PDB:6v93A	0.079	0.063	3.234E-1	1259	0.039	0.029	6v93A.pdb.gz	Structure and mechanism of B-family DNA polymerase zeta specialized for translesion DNA synthesis.
17	PDB:6m5uA	0.074	0.112	3.384E-1	585	0.013	0.021	6m5uA.pdb.gz	Architecture of the herpesvirus genome-packaging complex and implications for DNA translocation.
18	PDB:5guhA	0.087	0.106	3.541E-1	759	0.016	0.020	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
19	PDB:6gwjK	0.098	0.184	4.058E-1	334	0.034	0.096	6gwjK.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
20	PDB:7oopM	0.079	0.088	4.058E-1	810	0.044	0.052	7oopM.pdb.gz	Structural basis of human transcription-DNA repair coupling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C0I1	0.0	1976	1111	1.000	0.854	A0A494C0I1_HUMAN GTF2I repeat domain containing 2 OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=1
2	A0A494C1N8	0.0	1956	1116	0.993	0.844	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
3	Q6EKJ0	0.0	1958	949	0.993	0.993	GTD2B_HUMAN General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
4	Q86UP8	0.0	1972	949	1.000	1.000	GTD2A_HUMAN General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3
5	Q99NI3	0.0	1545	936	0.788	0.799	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
6	X5DNP5	2.70e-154	482	978	0.280	0.272	X5DNP5_HUMAN General transcription factor IIi isoform B (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
7	P78347	7.23e-150	471	998	0.280	0.267	GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2
8	X5DR09	7.23e-150	471	998	0.280	0.267	X5DR09_HUMAN General transcription factor IIi isoform A (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
9	A0A494C1K3	8.47e-149	473	1159	0.279	0.229	A0A494C1K3_HUMAN General transcription factor IIi OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=1
10	X5D2J9	8.73e-148	464	957	0.267	0.264	X5D2J9_HUMAN General transcription factor IIi isoform D (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
11	Q5U2Y1	1.30e-147	464	979	0.263	0.255	GTF2I_RAT General transcription factor II-I OS=Rattus norvegicus OX=10116 GN=Gtf2i PE=1 SV=2
12	Q9ESZ8	6.22e-144	455	998	0.264	0.252	GTF2I_MOUSE General transcription factor II-I OS=Mus musculus OX=10090 GN=Gtf2i PE=1 SV=3
13	X5D939	4.51e-143	452	977	0.267	0.259	X5D939_HUMAN General transcription factor IIi isoform C (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
14	Q7L775	7.20e-57	209	607	0.171	0.267	EPMIP_HUMAN EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1
15	Q8VEH5	5.07e-51	192	606	0.158	0.248	EPMIP_MOUSE EPM2A-interacting protein 1 OS=Mus musculus OX=10090 GN=Epm2aip1 PE=1 SV=1
16	E9PFE2	6.55e-46	181	960	0.143	0.142	E9PFE2_HUMAN GTF2I repeat domain containing 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1 PE=1 SV=1
17	Q9UHL9	7.80e-46	181	959	0.143	0.142	GT2D1_HUMAN General transcription factor II-I repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1 PE=1 SV=1
18	B2RPU8	1.52e-42	169	756	0.128	0.160	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
19	Q9JI57	1.56e-42	171	1104	0.137	0.118	GT2D1_MOUSE General transcription factor II-I repeat domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gtf2ird1 PE=2 SV=2
20	B7ZQJ9	2.46e-42	170	993	0.146	0.140	GT2D1_XENLA General transcription factor II-I repeat domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gtf2ird1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14291 DUF4371	0.00013	33.2	Domain of unknown function (DUF4371)
2	PF17279 DUF5344	5.9e+02	12.4	Family of unknown function (DUF5344)
3	PF02946 GTF2I	3.4e-51	182.7	GTF2I-like repeat
4	PF18658 zf-C2H2_12	0.007	27.3	Spin-doc zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406723

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480524	0.914	General transcription factor II-I repeat domain-containing protein 2B
2	9606.ENSP00000289473	0.648	Neutrophil cytosol factor 1
3	9606.ENSP00000351807	0.540	Elastin
4	9606.ENSP00000405699	0.519	Zinc finger protein 837

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0048583	0.887	regulation of response to stimulus
GO:0050794	0.865	regulation of cellular process
GO:0051239	0.730	regulation of multicellular organismal process
GO:0044057	0.542	regulation of system process
GO:0048518	0.527	positive regulation of biological process
GO:0080090	0.454	regulation of primary metabolic process
GO:0048522	0.436	positive regulation of cellular process
GO:0060255	0.432	regulation of macromolecule metabolic process
GO:0051171	0.425	regulation of nitrogen compound metabolic process
GO:0031323	0.422	regulation of cellular metabolic process
GO:0009889	0.407	regulation of biosynthetic process
GO:0009987	0.383	cellular process
GO:0090257	0.366	regulation of muscle system process
GO:0043502	0.363	regulation of muscle adaptation
GO:0010556	0.355	regulation of macromolecule biosynthetic process
GO:0031326	0.343	regulation of cellular biosynthetic process
GO:0010468	0.335	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]