StarFunc result for job id Q86UQ0

User Input

>input (364 residues)
MWAPREQLLGWTAEALPAKDSAWPWEEKPRYLGPVTFEDVAVLFTEAEWKRLSLEQRNLY
KEVMLENLRNLVSLAESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGN
PCPEDQPQSQHPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWG
GNRILEIQLSPAQNASSEEVDRISKRAETPGFGAVTFGECALAFNQKSNLFRQKAVTAEK
SSDKRQSQVCRECGRGFSRKSQLIIHQRTHTGEKPYVCGECGRGFIVESVLRNHLSTHSG
EKPYVCSHCGRGFSCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPY
VCRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UQ0	1.000	1.000	4.863E-62	364	1.000	1.000	Q86UQ0.pdb.gz	ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens OX=9606 GN=ZNF589 PE=1 SV=1
2	AFDB:P52736	0.304	0.176	1.004E-24	654	0.442	0.246	P52736.pdb.gz	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
3	AFDB:Q6P1L6	0.309	0.193	6.021E-24	599	0.434	0.264	Q6P1L6.pdb.gz	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
4	AFDB:Q9Y3M9	0.178	0.104	7.003E-22	751	0.354	0.172	Q9Y3M9.pdb.gz	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
5	AFDB:Q9BSG1	0.319	0.275	3.225E-20	425	0.294	0.252	Q9BSG1.pdb.gz	ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens OX=9606 GN=ZNF2 PE=1 SV=5
6	AFDB:Q6PK81	0.296	0.248	3.648E-20	442	0.313	0.258	Q6PK81.pdb.gz	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
7	AFDB:Q16587	0.323	0.187	5.285E-20	644	0.349	0.197	Q16587.pdb.gz	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
8	AFDB:P17014	0.327	0.175	5.622E-20	697	0.327	0.171	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
9	AFDB:Q86Y25	0.316	0.212	1.180E-19	554	0.302	0.199	Q86Y25.pdb.gz	Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens OX=9606 GN=ZNF354C PE=1 SV=1
10	AFDB:Q9EQB9	0.335	0.165	1.180E-19	759	0.277	0.133	Q9EQB9.pdb.gz	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
11	PDB:3w5kB	0.116	0.250	1.432E-4	110	0.107	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.064	0.099	1.182	208	0.085	0.149	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:2c1dA	0.070	0.084	1.712	264	0.030	0.042	2c1dA.pdb.gz	Structure of the Cytochrome Complex Soxxa of Paracoccus Pantotrophus, a Heme Enzyme Initiating Chemotrophic Sulfur Oxidation.
14	PDB:7ad8D	0.063	0.077	1.712	280	0.060	0.079	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:5gm6a	0.043	0.096	2.191	123	0.049	0.146	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7zsb4	0.057	0.065	2.331	306	0.058	0.069	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
17	PDB:4r8pL	0.063	0.083	2.806	254	0.033	0.047	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
18	PDB:7dvqM	0.062	0.102	3.821	191	0.085	0.162	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:2ja2A	0.061	0.053	4.064	485	0.033	0.025	2ja2A.pdb.gz
20	PDB:7o9k6	0.060	0.065	4.064	331	0.060	0.066	7o9k6.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86UQ0	0.0	756	364	1.000	1.000	ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens OX=9606 GN=ZNF589 PE=1 SV=1
2	B4DQF9	6.44e-111	323	177	0.426	0.876	B4DQF9_HUMAN Zinc finger protein 589 OS=Homo sapiens OX=9606 GN=ZNF589 PE=1 SV=1
3	Q6P1L6	4.22e-96	299	599	0.497	0.302	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
4	P52736	3.81e-91	288	654	0.467	0.260	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
5	Q9NQV7	8.04e-72	242	894	0.376	0.153	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
6	Q96EQ9	1.56e-60	210	843	0.360	0.155	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
7	Q14929	3.00e-60	206	603	0.393	0.237	ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens OX=9606 GN=ZNF169 PE=1 SV=3
8	Q9Y3M9	1.39e-58	204	751	0.354	0.172	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
9	Q8N9F8	4.96e-50	177	522	0.341	0.238	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
10	Q9GZX5	1.83e-48	173	532	0.357	0.244	ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens OX=9606 GN=ZNF350 PE=1 SV=3
11	Q5T5D7	5.28e-48	168	378	0.297	0.286	ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens OX=9606 GN=ZNF684 PE=2 SV=1
12	Q9P2J8	9.92e-48	175	865	0.352	0.148	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
13	O94892	1.58e-47	172	652	0.327	0.183	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
14	Q96JC4	2.20e-47	170	524	0.330	0.229	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
15	Q8N883	1.47e-46	169	585	0.209	0.130	ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens OX=9606 GN=ZNF614 PE=1 SV=2
16	Q16587	6.37e-46	168	644	0.319	0.180	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
17	Q6ZNG0	9.91e-46	163	422	0.338	0.291	ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens OX=9606 GN=ZNF620 PE=1 SV=1
18	Q14592	1.06e-45	166	562	0.327	0.212	ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens OX=9606 GN=ZNF460 PE=1 SV=2
19	Q6PF04	1.15e-45	167	617	0.234	0.138	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2
20	F8WEZ9	2.60e-45	164	492	0.341	0.252	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09947 DUF2180	52	15.2	Uncharacterized protein conserved in archaea (DUF2180)
2	PF01352 KRAB	4.7e-17	72.6	KRAB box
3	PF00096 zf-C2H2	4.7e-18	75.7	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	63	14.8	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	7.2e-13	59.2	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	41	15.6	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	4.8e-07	41.1	Zinc-finger double-stranded RNA-binding
8	PF05605 zf-Di19	2.1e+02	13.6	Drought induced 19 protein (Di19), zinc-binding
9	PF13465 zf-H2C2_2	5.8e-19	78.8	Zinc-finger double domain
10	PF12874 zf-met	25	16.7	Zinc-finger of C2H2 type
11	PF17032 zinc_ribbon_15	7.4e+02	12.3	zinc-ribbon family
12	PF14369 zinc_ribbon_9	0.012	27.2	zinc-ribbon
13	PF09723 Zn-ribbon_8	1.5e+02	13.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346729

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414909	0.519	Uncharacterized protein C1orf167

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.998	transcription regulator activity
GO:0003700	0.985	DNA-binding transcription factor activity
GO:0000981	0.981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.979	sequence-specific DNA binding
GO:0003690	0.962	double-stranded DNA binding
GO:1990837	0.953	sequence-specific double-stranded DNA binding
GO:0000976	0.800	transcription cis-regulatory region binding
GO:0000977	0.738	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001217	0.609	DNA-binding transcription repressor activity
GO:0001227	0.600	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0031327	0.985	negative regulation of cellular biosynthetic process
GO:0045892	0.983	negative regulation of DNA-templated transcription
GO:0000122	0.941	negative regulation of transcription by RNA polymerase II
GO:0009987	0.640	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005737	0.839	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]