StarFunc result for job id Q86UR5

User Input

>input (1692 residues)
MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRD
MAKPAACKTPRNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICH
KTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFF
GSGPQQTSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAASSQDAAPPSAPPD
RSKGAEPSQQALGPEQKQASSRSRSEPPRERKKTPGLSEQNGKGALKSERKRVPKTSAQP
VEGAVEERERKERRESRRLEKGRSQDYPDTPEKRDEGKAADEEKQRKEEDYQTRYRSDPN
LARYPVKPPPEEQQMRMHARVSRARHERRHSDVALPRTEAGAALPEGKAGKRAPAAARAS
PPDSPRAYSAERTAETRAPGAKQLTNHSPPAPRHGPVPAEAPELKAQEPLRKQSRLDPSS
AVLMRKAKREKVETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGVST
PEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRV
ILNKRTTMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWN
GKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKME
RPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPARVDGRPRNP
YVKMYFLPDRSDKSKRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQE
EESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQR
SQRISDSDISDYEVDDGIGVVPPVGYRSSARESKSTTLTVPEQQRTTHHRSRSVSPHRGN
DQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSEL
LMLPRAKRGRSAECLHTTRHLVRHYKTLPPKMPLLQSSSHWNIYSSILPAHTKTKSVTRQ
DISLHHECFNSTVLRFTDEILVSELQPFLDRARSASTNCLRPDTSLHSPERERGRWSPSL
DRRRPPSPRIQIQHASPENDRHSRKSERSSIQKQTRKGTASDAERVLPTCLSRRGHAAPR
ATDQPVIRGKHPARSRSSEHSSIRTLCSMHHLVPGGSAPPSPLLTRMHRQRSPTQSPPAD
TSFSSRRGRQLPQVPVRSGSIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQELDREQYS
KYNIHKDQYRSCDNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRISSFT
PKMQGRRMGTSGRSIMKSTSVSGEMYTLEHNDGSQSDTAVGTVGAGGKKRRSSLSAKVVA
IVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSSE
GNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRA
RSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQ
VIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSS
LESSTGPPCIRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UR5	1.000	1.000	0.000	1692	1.000	1.000	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
2	AFDB:Q99NE5	0.323	0.365	0.000	1463	0.807	0.933	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
3	AFDB:Q9EQZ7	0.144	0.157	0.000	1530	0.553	0.612	Q9EQZ7.pdb.gz	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
4	AFDB:Q9JIR4	0.415	0.433	0.000	1615	0.876	0.918	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
5	AFDB:Q9JIS1	0.271	0.290	0.000	1555	0.575	0.626	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
6	AFDB:Q9UQ26	0.246	0.286	0.000	1411	0.506	0.607	Q9UQ26.pdb.gz	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
7	AFDB:Q22366	0.132	0.139	2.165E-62	1563	0.238	0.257	Q22366.pdb.gz	RIM_CAEEL Rab-3-interacting molecule unc-10 OS=Caenorhabditis elegans OX=6239 GN=unc-10 PE=2 SV=2
8	PDB:3pfqA	0.076	0.231	5.546E-11	523	0.024	0.078	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
9	AFDB:Q17353	0.048	0.058	1.143E-10	1379	0.111	0.136	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
10	AFDB:Q5TCQ9	0.058	0.065	1.039E-9	1481	0.079	0.090	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
11	AFDB:P27715	0.080	0.065	1.879E-9	2155	0.102	0.080	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
12	PDB:5ixcA	0.052	0.126	1.113E-6	684	0.014	0.035	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:5izrC	0.053	0.132	3.266E-6	659	0.016	0.041	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:1cjyA	0.052	0.134	6.940E-6	633	0.016	0.043	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
15	PDB:5iz5B	0.052	0.116	1.068E-5	746	0.014	0.032	5iz5B.pdb.gz
16	PDB:5a50A	0.047	0.433	1.189E-5	165	0.012	0.127	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:5a52A	0.047	0.464	1.397E-5	154	0.012	0.130	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:4rj9A	0.047	0.442	2.037E-5	161	0.013	0.137	4rj9A.pdb.gz
19	PDB:5iz5A	0.051	0.110	2.037E-5	757	0.015	0.034	5iz5A.pdb.gz
20	PDB:7pc3A	0.050	0.200	1.271E-4	405	0.015	0.062	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86UR5	0.0	3456	1692	1.000	1.000	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
2	Q99NE5	0.0	1980	1463	0.613	0.709	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
3	Q9EQZ7	0.0	1050	1530	0.360	0.398	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
4	Q9JIR4	0.0	2660	1615	0.861	0.902	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
5	Q9JIS1	0.0	1085	1555	0.364	0.396	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
6	Q9UQ26	0.0	1023	1411	0.360	0.432	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
7	Q9UJD0	3.78e-119	379	308	0.119	0.653	RIMS3_HUMAN Regulating synaptic membrane exocytosis protein 3 OS=Homo sapiens OX=9606 GN=RIMS3 PE=1 SV=1
8	Q80U57	2.22e-116	372	307	0.119	0.658	RIMS3_MOUSE Regulating synaptic membrane exocytosis protein 3 OS=Mus musculus OX=10090 GN=Rims3 PE=1 SV=2
9	Q9JIR3	3.22e-116	371	307	0.119	0.655	RIMS3_RAT Regulating synaptic membrane exocytosis protein 3 OS=Rattus norvegicus OX=10116 GN=Rims3 PE=1 SV=1
10	P60191	3.30e-95	310	269	0.095	0.599	RIMS4_MOUSE Regulating synaptic membrane exocytosis protein 4 OS=Mus musculus OX=10090 GN=Rims4 PE=1 SV=1
11	Q9H426	1.02e-94	309	269	0.095	0.599	RIMS4_HUMAN Regulating synaptic membrane exocytosis protein 4 OS=Homo sapiens OX=9606 GN=RIMS4 PE=1 SV=3
12	Q8CIX1	3.98e-94	307	269	0.095	0.595	RIMS4_RAT Regulating synaptic membrane exocytosis protein 4 OS=Rattus norvegicus OX=10116 GN=Rims4 PE=1 SV=1
13	A0A0B4K7E1	4.24e-56	218	1955	0.093	0.081	A0A0B4K7E1_DROME Rab3 interacting molecule, isoform U OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
14	A0A0B4K742	1.49e-55	217	2595	0.081	0.053	A0A0B4K742_DROME Rab3 interacting molecule, isoform W OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
15	A0A0B4K6M2	8.33e-55	214	2798	0.061	0.037	A0A0B4K6M2_DROME Rab3 interacting molecule, isoform F OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
16	Q9VEE5	4.16e-54	211	1931	0.087	0.077	Q9VEE5_DROME Rab3 interacting molecule, isoform Q OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=5
17	A0A0B4K677	5.62e-54	211	1621	0.087	0.091	A0A0B4K677_DROME Rab3 interacting molecule, isoform Y OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
18	A0A0B4K679	6.26e-54	211	1965	0.106	0.091	A0A0B4K679_DROME Rab3 interacting molecule, isoform V OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
19	A0A0B4K6B7	9.55e-54	210	1655	0.106	0.108	A0A0B4K6B7_DROME Rab3 interacting molecule, isoform Z OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
20	A0A0B4K6B1	4.83e-53	208	2792	0.056	0.034	A0A0B4K6B1_DROME Rab3 interacting molecule, isoform P OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	8.8e-35	130.5	C2 domain
2	PF02318 FYVE_2	0.00043	31.8	FYVE-type zinc finger
3	PF14803 Nudix_N_2	28	16.1	Nudix N-terminal
4	PF00595 PDZ	2.5e-06	39.1	PDZ domain
5	PF17820 PDZ_6	0.074	24.3	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428417

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367756	0.999	Protein unc-13 homolog B
2	9606.ENSP00000222256	0.996	Ras-related protein Rab-3A
3	9606.ENSP00000254976	0.988	Synaptosomal-associated protein 25
4	9606.ENSP00000429562	0.984	Protein unc-13 homolog A
5	9606.ENSP00000345824	0.983	Benzodiazepine receptor (peripheral) associated protein 1
6	9606.ENSP00000468263	0.974	ELKS/Rab6-interacting/CAST family member 1
7	9606.ENSP00000222812	0.967	Syntaxin-1A
8	9606.ENSP00000296452	0.956	Protein bassoon
9	9606.ENSP00000314214	0.952	Vesicle-associated membrane protein 2
10	9606.ENSP00000265381	0.945	Amyloid-beta A4 precursor protein-binding family A member 1
11	9606.ENSP00000261655	0.941	RIMS-binding protein 2
12	9606.ENSP00000362399	0.940	Syntaxin-binding protein 1
13	9606.ENSP00000221459	0.929	Protein lin-7 homolog B
14	9606.ENSP00000367408	0.926	Peripheral plasma membrane protein CASK
15	9606.ENSP00000351832	0.922	Rab3 GTPase-activating protein non-catalytic subunit
16	9606.ENSP00000278193	0.912	Protein lin-7 homolog C
17	9606.ENSP00000447488	0.912	Protein lin-7 homolog A
18	9606.ENSP00000305613	0.900	Complexin-1
19	9606.ENSP00000450337	0.899	Liprin-alpha-2
20	9606.ENSP00000288221	0.897	ERC protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.625	organic cyclic compound binding
GO:1901363	0.619	heterocyclic compound binding
GO:0003676	0.565	nucleic acid binding
GO:0098772	0.556	molecular function regulator activity
GO:0030695	0.547	GTPase regulator activity
GO:0003723	0.482	RNA binding
GO:0019899	0.414	enzyme binding
GO:0051020	0.346	GTPase binding
GO:0031267	0.306	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0065008	0.965	regulation of biological quality
GO:0051641	0.935	cellular localization
GO:0006836	0.927	neurotransmitter transport
GO:0023061	0.925	signal release
GO:0045055	0.924	regulated exocytosis
GO:0032879	0.920	regulation of localization
GO:0007268	0.916	chemical synaptic transmission
GO:0051649	0.915	establishment of localization in cell
GO:0050804	0.885	modulation of chemical synaptic transmission
GO:0099643	0.867	signal release from synapse
GO:0048522	0.866	positive regulation of cellular process
GO:0007269	0.860	neurotransmitter secretion
GO:0099003	0.841	vesicle-mediated transport in synapse
GO:0051128	0.836	regulation of cellular component organization
GO:0071840	0.791	cellular component organization or biogenesis
GO:0016043	0.778	cellular component organization
GO:0099504	0.711	synaptic vesicle cycle
GO:0051049	0.699	regulation of transport
GO:0042391	0.675	regulation of membrane potential
GO:0031644	0.655	regulation of nervous system process
GO:0048167	0.619	regulation of synaptic plasticity
GO:0050896	0.389	response to stimulus
GO:0016079	0.362	synaptic vesicle exocytosis
GO:0010647	0.361	positive regulation of cell communication
GO:0023056	0.356	positive regulation of signaling
GO:0031646	0.342	positive regulation of nervous system process
GO:0022607	0.332	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0071944	0.997	cell periphery
GO:0048786	0.997	presynaptic active zone
GO:0005886	0.992	plasma membrane
GO:0005829	0.991	cytosol
GO:0043226	0.944	organelle
GO:0043227	0.895	membrane-bounded organelle
GO:0043231	0.721	intracellular membrane-bounded organelle
GO:0098590	0.606	plasma membrane region
GO:0005938	0.549	cell cortex
GO:0098831	0.420	presynaptic active zone cytoplasmic component
GO:0031982	0.396	vesicle
GO:0097060	0.362	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]