StarFunc result for job id Q86US8

User Input

>input (1419 residues)
MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLR
NKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDPENNRGQES
FPRTAGQEDRSLKIIKRTKKPDLQIYQPGRRLQTVSKESASRVEEEEVLNQVEQLRVEED
ECRGNVAKEEVANKPDRAEIEKSPGGGRVGAAKGEKGKRMGKGEGVRETHDDPARGRPGS
AKRYSRSDKRRNRYRTRSTSSAGSNNSAEGAGLTDNGCRRRRQDRTKERPRLKKQVSVSS
TDSLDEDRIDEPDGLGPRRSSERKRHLERNWSGRGEGEQKNSAKEYRGTLRVTFDAEAMN
KESPMVRSARDDMDRGKPDKGLSSGGKGSEKQESKNPKQELRGRGRGILILPAHTTLSVN
SAGSPESAPLGPRLLFGSGSKGSRSWGRGGTTRRLWDPNNPDQKPALKTQTPQLHFLDTD
DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQYPVGPTNGVYP
GPYYPGYPTPSGQYVCSPLPTSTMSPEEVEQHMRNLQQQELHRLLRVADNQELQLSNLLS
RDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLVK
DPNVENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKY
ALISAQRCMICQGDIARYREQASDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTR
RKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDLSPDQWRKGKK
STFRHVGDDTTRLEIWIHPSHPRSSQGTESGKDSEQENGLGSLSPSDLNKRFILSFLHAH
GKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVHNSQLKDCFS
EECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLK
ELLPSVKVWSDWMLGYPDTWNPPPTSLDLPSHVAVDVWSTLADFCNILTAVNQSEVPLYK
DPDDDLTLLILEEDRLLSGFVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCG
QEEPLLAFKGGKYVSVAPVPDTMGKEMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGED
DIRELRAKKLALARKIAEQQRRQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLA
SLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFES
RDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPI
RLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86US8	1.000	1.000	0.000	1419	1.000	1.000	Q86US8.pdb.gz	EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2
2	AFDB:A0A0R4IZ84	0.520	0.483	8.663E-93	1544	0.528	0.485	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
3	AFDB:B3DI22	0.271	0.336	1.894E-7	1130	0.087	0.109	B3DI22.pdb.gz	B3DI22_DANRE Nonsense-mediated mRNA decay factor OS=Danio rerio OX=7955 GN=wu:fa99h10 PE=1 SV=1
4	AFDB:Q92540	0.261	0.320	4.779E-7	1137	0.084	0.105	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
5	AFDB:F4K0Y5	0.072	0.082	3.876E-6	1165	0.094	0.114	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
6	AFDB:Q7Z5K2	0.110	0.121	5.052E-4	1190	0.106	0.127	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
7	AFDB:Q6A070	0.070	0.061	5.260E-4	1776	0.111	0.089	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
8	AFDB:Q9P2D8	0.095	0.065	1.043E-3	2635	0.118	0.064	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
9	AFDB:Q54L90	0.069	0.064	1.439E-3	1601	0.114	0.101	Q54L90.pdb.gz	GFLB_DICDI Ras guanine nucleotide exchange factor glfB OS=Dictyostelium discoideum OX=44689 GN=gflB PE=1 SV=1
10	AFDB:X2JAX8	0.047	0.049	2.739E-3	1330	0.078	0.083	X2JAX8.pdb.gz	X2JAX8_DROME Nostrin, isoform H OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
11	PDB:7r5j00	0.098	0.154	3.355E-3	756	0.058	0.108	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:6h25J	0.077	0.118	3.637E-3	868	0.022	0.036	6h25J.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
13	PDB:7dkhI	0.074	0.094	6.652E-3	914	0.048	0.074	7dkhI.pdb.gz
14	PDB:7ntfA	0.068	0.087	6.652E-3	918	0.044	0.068	7ntfA.pdb.gz
15	PDB:6tedQ	0.066	0.091	9.948E-3	890	0.040	0.064	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
16	PDB:4ifdJ	0.078	0.112	1.373E-2	948	0.025	0.037	4ifdJ.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
17	PDB:4bujB	0.089	0.091	1.748E-2	1367	0.050	0.052	4bujB.pdb.gz
18	PDB:5dseA	0.069	0.146	1.894E-2	537	0.044	0.117	5dseA.pdb.gz
19	PDB:6zceq	0.077	0.117	1.972E-2	636	0.045	0.101	6zceq.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
20	PDB:5mqfO	0.054	0.102	2.511E-2	564	0.048	0.121	5mqfO.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IZ84	0.0	1228	1544	0.495	0.455	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
2	Q86US8	0.0	2923	1419	1.000	1.000	EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2
3	Q86BS8	1.14e-61	231	949	0.149	0.223	Q86BS8_DROME SMG6 protein OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
4	Q9VBZ6	5.14e-61	229	948	0.149	0.223	Q9VBZ6_DROME GH14566p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=2
5	Q8MZI0	1.43e-57	214	688	0.137	0.282	Q8MZI0_DROME GM14040p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
6	A9QM73	1.81e-28	127	1059	0.101	0.136	SMG7_ARATH Nonsense-mediated mRNA decay factor SMG7 OS=Arabidopsis thaliana OX=3702 GN=SMG7 PE=1 SV=1
7	Q1T6W7	4.39e-27	122	1219	0.065	0.075	Q1T6W7_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=2
8	Q9BL68	3.69e-23	109	1241	0.065	0.074	Q9BL68_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=3
9	B3DI22	3.82e-21	103	1130	0.046	0.058	B3DI22_DANRE Nonsense-mediated mRNA decay factor OS=Danio rerio OX=7955 GN=wu:fa99h10 PE=1 SV=1
10	Q1LVF3	3.83e-21	103	1180	0.046	0.055	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
11	Q92540	5.92e-21	102	1137	0.046	0.057	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
12	E9PD50	7.84e-21	102	1170	0.046	0.056	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
13	F1R7R1	2.60e-19	97.1	1099	0.075	0.097	SMG5_DANRE Nonsense-mediated mRNA decay factor SMG5 OS=Danio rerio OX=7955 GN=smg5 PE=2 SV=1
14	B1ALB4	1.18e-18	94.7	756	0.043	0.081	B1ALB4_HUMAN SMG7 nonsense mediated mRNA decay factor (Fragment) OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=8
15	Q9UPR3	7.45e-14	79.3	1016	0.056	0.078	SMG5_HUMAN Nonsense-mediated mRNA decay factor SMG5 OS=Homo sapiens OX=9606 GN=SMG5 PE=1 SV=3
16	Q9P7J1	8.41e-08	58.9	465	0.037	0.112	SWT1_SCHPO Transcriptional protein swt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swt1 PE=3 SV=2
17	G5EF47	2.73e-07	57.4	458	0.035	0.109	G5EF47_CAEEL DNA/RNA-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-7 PE=1 SV=1
18	Q12104	1.03e-04	48.9	458	0.045	0.140	SWT1_YEAST Transcriptional protein SWT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWT1 PE=1 SV=1
19	Q7Z429	7.53e-04	45.8	371	0.020	0.078	LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1
20	Q9V414	0.001	46.2	1177	0.037	0.045	Q9V414_DROME LD36341p OS=Drosophila melanogaster OX=7227 GN=Smg5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10374 EST1	2.8e-11	55.4	Telomerase activating protein Est1
2	PF10373 EST1_DNA_bind	4.1e-58	208.7	Est1 DNA/RNA binding domain
3	PF13638 PIN_4	4.8e-18	77.1	PIN domain
4	PF18477 PIN_9	13	17.5	PIN like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000470142	0.999	Regulator of nonsense transcripts 1
2	9606.ENSP00000309572	0.995	Telomerase reverse transcriptase
3	9606.ENSP00000355261	0.965	Protein SMG5
4	9606.ENSP00000348708	0.955	Regulator of nonsense transcripts 2
5	9606.ENSP00000358563	0.947	H/ACA ribonucleoprotein complex subunit 4
6	9606.ENSP00000402515	0.946	Serine/threonine-protein kinase SMG1
7	9606.ENSP00000425133	0.941	Protein SMG7
8	9606.ENSP00000313007	0.936	Polyadenylate-binding protein 1
9	9606.ENSP00000276201	0.935	Regulator of nonsense transcripts 3B
10	9606.ENSP00000364289	0.932	Nuclear cap-binding protein subunit 1
11	9606.ENSP00000364448	0.924	Regulator of nonsense transcripts 3A
12	9606.ENSP00000264951	0.921	5'-3' exoribonuclease 1
13	9606.ENSP00000335153	0.918	Heat shock protein HSP 90-alpha
14	9606.ENSP00000270066	0.915	Protein SMG9
15	9606.ENSP00000482075	0.914	Prostaglandin E synthase 3
16	9606.ENSP00000438748	0.879	Protein SMG8
17	9606.ENSP00000326806	0.875	Nuclear cap-binding protein subunit 2
18	9606.ENSP00000416255	0.874	Eukaryotic translation initiation factor 4 gamma 1
19	9606.ENSP00000226444	0.817	Estrogen sulfotransferase
20	9606.ENSP00000334840	0.814	Proline-rich nuclear receptor coactivator 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043021	1.000	ribonucleoprotein complex binding
GO:0070182	1.000	DNA polymerase binding
GO:0070034	1.000	telomerase RNA binding
GO:0042162	1.000	telomeric DNA binding
GO:0004521	1.000	RNA endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019219	0.988	regulation of nucleobase-containing compound metabolic process
GO:0090304	0.987	nucleic acid metabolic process
GO:0044260	0.982	cellular macromolecule metabolic process
GO:0048519	0.977	negative regulation of biological process
GO:0016070	0.977	RNA metabolic process
GO:0010467	0.976	gene expression
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051128	0.975	regulation of cellular component organization
GO:0051052	0.966	regulation of DNA metabolic process
GO:0032210	0.958	regulation of telomere maintenance via telomerase
GO:0000956	0.958	nuclear-transcribed mRNA catabolic process
GO:0051236	0.957	establishment of RNA localization
GO:0050657	0.957	nucleic acid transport
GO:0051172	0.938	negative regulation of nitrogen compound metabolic process
GO:0031324	0.938	negative regulation of cellular metabolic process
GO:0000184	0.913	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0006405	0.903	RNA export from nucleus
GO:0051028	0.902	mRNA transport
GO:2001251	0.896	negative regulation of chromosome organization
GO:0006406	0.871	mRNA export from nucleus
GO:0045934	0.865	negative regulation of nucleobase-containing compound metabolic process
GO:0050790	0.840	regulation of catalytic activity
GO:0051972	0.811	regulation of telomerase activity
GO:0051053	0.509	negative regulation of DNA metabolic process
GO:0019220	0.497	regulation of phosphate metabolic process
GO:0035303	0.415	regulation of dephosphorylation
GO:0032205	0.343	negative regulation of telomere maintenance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005697	0.998	telomerase holoenzyme complex
GO:0035145	0.997	exon-exon junction complex
GO:0005730	0.995	nucleolus
GO:0005654	0.965	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]