StarFunc result for job id Q86UT6

User Input

>input (975 residues)
MRWGHHLPRASWGSGFRRALQRPDDRIPFLIHWSWPLQGERPFGPPRAFIRHHGSSVDSA
PPPGRHGRLFPSASATEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPPAELALEHQPPQAGLPPLALSQLFNPDACGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTPLKEVLPLMAAAGSHLLFV
LHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQASILVTTRPSAIGRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPYCGYAVGGSGVSATPAQRDHLVQMLSRNLEG
HHQIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLS
LMAYAARTMGKLAYEGVSSRKTYFSEEDVCGCLEAGIRTEEEFQLLHIFRRDALRFFLAP
CVEPGRAGTFVFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIM
AKLLPLRALPLLFNLIKVVPRVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGAS
ILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKK
KLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVL
GSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQ
ITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQEL
NVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSL
TEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVE
GEVRALLEQLGSSGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TL44	0.907	0.907	0.000	975	0.899	0.899	Q3TL44.pdb.gz	NLRX1_MOUSE NLR family member X1 OS=Mus musculus OX=10090 GN=Nlrx1 PE=1 SV=1
2	AFDB:Q9HC29	0.304	0.287	5.080E-33	1040	0.189	0.177	Q9HC29.pdb.gz	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
3	AFDB:F8W3K2	0.348	0.347	1.005E-32	980	0.194	0.193	F8W3K2.pdb.gz	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
4	AFDB:Q6E804	0.347	0.335	7.101E-32	1013	0.201	0.193	Q6E804.pdb.gz	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
5	AFDB:A0A0G2K4Z7	0.346	0.342	2.908E-31	989	0.170	0.168	A0A0G2K4Z7.pdb.gz	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
6	AFDB:Q8K3Z0	0.340	0.326	3.333E-31	1020	0.175	0.168	Q8K3Z0.pdb.gz	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
7	AFDB:E9Q5R7	0.307	0.288	7.220E-31	1054	0.198	0.183	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
8	AFDB:A0A0K0KIB0	0.342	0.349	9.484E-31	954	0.161	0.165	A0A0K0KIB0.pdb.gz	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
9	AFDB:D4A523	0.292	0.277	8.039E-30	1035	0.193	0.182	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
10	AFDB:H3BLT9	0.273	0.242	8.039E-30	1112	0.202	0.177	H3BLT9.pdb.gz	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
11	PDB:7pzcA	0.278	0.270	1.540E-23	1010	0.168	0.162	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.342	0.406	7.381E-19	806	0.167	0.202	7lfhA.pdb.gz
13	PDB:6npyA	0.236	0.281	1.080E-17	798	0.185	0.226	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.229	0.253	5.643E-16	866	0.133	0.150	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:3jblA	0.254	0.270	1.967E-11	909	0.147	0.157	3jblA.pdb.gz
16	PDB:6b5bA	0.249	0.211	1.745E-10	1199	0.150	0.122	6b5bA.pdb.gz
17	PDB:1a4yA	0.156	0.287	2.009E-7	460	0.074	0.157	1a4yA.pdb.gz
18	PDB:6o60C	0.131	0.231	2.450E-6	389	0.057	0.144	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:1k5dC	0.209	0.542	7.419E-5	344	0.053	0.151	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
20	PDB:6j5wA	0.143	0.166	1.607E-4	816	0.101	0.120	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TL44	0.0	1768	975	0.902	0.902	NLRX1_MOUSE NLR family member X1 OS=Mus musculus OX=10090 GN=Nlrx1 PE=1 SV=1
2	Q86UT6	0.0	1980	975	1.000	1.000	NLRX1_HUMAN NLR family member X1 OS=Homo sapiens OX=9606 GN=NLRX1 PE=1 SV=1
3	C9J0R6	9.99e-102	316	151	0.155	1.000	C9J0R6_HUMAN NLR family member X1 (Fragment) OS=Homo sapiens OX=9606 GN=NLRX1 PE=1 SV=1
4	Q5DU56	1.13e-24	113	1064	0.084	0.077	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
5	Q8R4B8	3.25e-23	108	1033	0.114	0.107	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
6	Q96P20	1.52e-22	106	1036	0.167	0.157	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
7	H3BLT9	6.34e-22	104	1112	0.099	0.087	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
8	C3VPR7	7.49e-22	104	1065	0.098	0.090	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
9	Q7RTR2	7.49e-22	104	1065	0.098	0.090	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
10	Q8WX94	9.07e-22	104	980	0.103	0.102	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
11	A0A386CAB9	2.26e-21	103	1355	0.097	0.070	NLRP1_DANRE NACHT, LRR and PYD domains-containing protein 1 homolog OS=Danio rerio OX=7955 GN=nlrp1 PE=1 SV=1
12	E9Q5R7	2.57e-21	102	1054	0.192	0.177	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
13	D4A523	2.58e-21	102	1035	0.117	0.110	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
14	P59044	5.36e-21	101	892	0.128	0.140	NLRP6_HUMAN NACHT, LRR and PYD domains-containing protein 6 OS=Homo sapiens OX=9606 GN=NLRP6 PE=1 SV=2
15	J3KN39	1.34e-20	100	1059	0.106	0.097	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
16	Q9NX02	1.35e-20	100	1062	0.106	0.097	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
17	D9I2G4	4.97e-19	95.5	1218	0.111	0.089	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
18	Q9R1M5	9.92e-19	94.7	1163	0.103	0.086	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
19	Q86W24	1.38e-18	94.0	1093	0.095	0.085	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
20	D9I2G3	1.71e-18	94.0	1218	0.111	0.089	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	83	15.0	AAA ATPase domain
2	PF13401 AAA_22	35	16.1	AAA domain
3	PF13481 AAA_25	2.2e+02	12.8	AAA domain
4	PF05673 DUF815	1.2e+02	13.2	Protein of unknown function (DUF815)
5	PF13516 LRR_6	2.4e-05	35.1	Leucine Rich repeat
6	PF05729 NACHT	3.5e-17	74.3	NACHT domain
7	PF17776 NLRC4_HD2	1.7	20.7	NLRC4 helical domain HD2
8	PF17779 NOD2_WH	3.8	19.2	NOD2 winged helix domain
9	PF02367 TsaE	1.8e+02	13.5	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387334

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401980	0.998	Mitochondrial antiviral-signaling protein
2	9606.ENSP00000433623	0.991	TNF receptor-associated factor 6
3	9606.ENSP00000268379	0.988	Cytochrome b-c1 complex subunit 2, mitochondrial
4	9606.ENSP00000322439	0.987	Elongation factor Tu, mitochondrial
5	9606.ENSP00000369213	0.969	Probable ATP-dependent RNA helicase DDX58
6	9606.ENSP00000263642	0.959	Interferon-induced helicase C domain-containing protein 1
7	9606.ENSP00000323889	0.945	E3 ubiquitin/ISG15 ligase TRIM25
8	9606.ENSP00000328340	0.931	E3 ubiquitin-protein ligase RNF135
9	9606.ENSP00000468032	0.897	Sterile alpha and TIR motif-containing protein 1
10	9606.ENSP00000358072	0.858	Autophagy protein 5
11	9606.ENSP00000454207	0.758	TNF receptor-associated factor 3
12	9606.ENSP00000369618	0.742	FAST kinase domain-containing protein 5, mitochondrial
13	9606.ENSP00000355231	0.709	Beclin-1
14	9606.ENSP00000428579	0.696	NACHT domain- and WD repeat-containing protein 1
15	9606.ENSP00000485010	0.691	MHC class II transactivator
16	9606.ENSP00000471896	0.682	Interferon regulatory factor 3
17	9606.ENSP00000352438	0.673	Poly(rC)-binding protein 2
18	9606.ENSP00000385090	0.641	NLR family CARD domain-containing protein 4
19	9606.ENSP00000375872	0.635	Autophagy-related protein 16-1
20	9606.ENSP00000369558	0.630	Interferon alpha-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.391	heterocyclic compound binding
GO:0097159	0.390	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0048583	0.992	regulation of response to stimulus
GO:0010468	0.990	regulation of gene expression
GO:0032101	0.979	regulation of response to external stimulus
GO:0051239	0.967	regulation of multicellular organismal process
GO:0080134	0.967	regulation of response to stress
GO:0031347	0.962	regulation of defense response
GO:0045088	0.951	regulation of innate immune response
GO:0048519	0.950	negative regulation of biological process
GO:0043122	0.950	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032479	0.948	regulation of type I interferon production
GO:0032675	0.937	regulation of interleukin-6 production
GO:1902532	0.912	negative regulation of intracellular signal transduction
GO:0002683	0.908	negative regulation of immune system process
GO:0002832	0.907	negative regulation of response to biotic stimulus
GO:0032102	0.888	negative regulation of response to external stimulus
GO:0048518	0.885	positive regulation of biological process
GO:0031348	0.875	negative regulation of defense response
GO:0050777	0.872	negative regulation of immune response
GO:0050896	0.860	response to stimulus
GO:0001818	0.860	negative regulation of cytokine production
GO:0009987	0.853	cellular process
GO:0002700	0.825	regulation of production of molecular mediator of immune response
GO:0062207	0.742	regulation of pattern recognition receptor signaling pathway
GO:0051171	0.719	regulation of nitrogen compound metabolic process
GO:0080090	0.715	regulation of primary metabolic process
GO:0031323	0.703	regulation of cellular metabolic process
GO:0048584	0.675	positive regulation of response to stimulus
GO:0009893	0.644	positive regulation of metabolic process
GO:0010604	0.618	positive regulation of macromolecule metabolic process
GO:0048522	0.578	positive regulation of cellular process
GO:0050688	0.555	regulation of defense response to virus
GO:0009605	0.544	response to external stimulus
GO:0051716	0.538	cellular response to stimulus
GO:0050727	0.533	regulation of inflammatory response
GO:0006950	0.529	response to stress
GO:0071704	0.512	organic substance metabolic process
GO:0044419	0.507	biological process involved in interspecies interaction between organisms
GO:0009607	0.507	response to biotic stimulus
GO:0044238	0.484	primary metabolic process
GO:0031349	0.474	positive regulation of defense response
GO:0051707	0.459	response to other organism
GO:0002376	0.458	immune system process
GO:0006807	0.458	nitrogen compound metabolic process
GO:0032103	0.445	positive regulation of response to external stimulus
GO:0032648	0.445	regulation of interferon-beta production
GO:0051252	0.437	regulation of RNA metabolic process
GO:0065009	0.435	regulation of molecular function
GO:0002718	0.427	regulation of cytokine production involved in immune response
GO:0006355	0.426	regulation of DNA-templated transcription
GO:0050687	0.422	negative regulation of defense response to virus
GO:0051090	0.417	regulation of DNA-binding transcription factor activity
GO:0043124	0.416	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045824	0.401	negative regulation of innate immune response
GO:0006952	0.393	defense response
GO:0043170	0.391	macromolecule metabolic process
GO:0032715	0.385	negative regulation of interleukin-6 production
GO:0050778	0.380	positive regulation of immune response
GO:0001819	0.380	positive regulation of cytokine production
GO:0042221	0.366	response to chemical
GO:0032480	0.361	negative regulation of type I interferon production
GO:0002701	0.346	negative regulation of production of molecular mediator of immune response
GO:1902533	0.336	positive regulation of intracellular signal transduction
GO:0010033	0.327	response to organic substance
GO:0039531	0.324	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0098542	0.321	defense response to other organism
GO:0045089	0.307	positive regulation of innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0016020	0.986	membrane
GO:0005829	0.985	cytosol
GO:0031090	0.964	organelle membrane
GO:0098588	0.925	bounding membrane of organelle
GO:0071944	0.762	cell periphery
GO:0005886	0.615	plasma membrane
GO:0019867	0.500	outer membrane
GO:0031966	0.496	mitochondrial membrane
GO:0005741	0.424	mitochondrial outer membrane
GO:0005634	0.317	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]