StarFunc result for job id Q86UU0

User Input

>input (1499 residues)
MRILANKTRLPHPRRREAPGSPPLSPRGHCPPAPAKPMHPENKLTNHGKTGNGGAQSQHQ
NVNQGPTCNVGSKGVGAGNHGAKANQISPSNSSLKNPQAGVPPFSSLKGKVKRDRSVSVD
SGEQREAGTPSLDSEAKEVAPRSKRRCVLERKQPYSGDEWCSGPDSEEDDKPIGATHNCN
VADPAMAAPQLGPGQTTQLPLSESSVPGAPHGPPPGLRPDAPGGGGGGGGVPGKPPSQFV
YVFTTHLANTAAEAVLQGRADSILAYHQQNVPRAKLDQAPKVPPTPEPLPLSTPSAGTPQ
SQPPPLPPPPPPAPGSAPPALPPEGPPEDSSQDLAPNSVGAASTGGGTGGTHPNTPTATT
ANNPLPPGGDPSSAPGPALLGEAAAPGNGQRSLVGSEGLSKEQLEHRERSLQTLRDIERL
LLRSGETEPFLKGPPGGAGEGGPPAQAPPPPQQPPTAPPSGLKKYEEPLQSMISQTQSLG
GPPLEHEVPGHPPGGDMGQQMNMMIQRLGQDSLTPEQVAWRKLQEEYYEEKRRKEEQIGL
HGSRPLQDMMGMGGMMVRGPPPPYHSKPGDQWPPGMGAQLRGPMDVQDPMQLRGGPPFPG
PRFPGNQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQNTMPYP
GGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQSMEMERMMQAHRQMDP
AMFPGQMAGGEGLAGTPMGMEFGGGRGLLSPPMGQSGLREVDPPMGPGNLNMNMNVNMNM
NMNLNVQMTPQQQMLMSQKMRGPGDLMGPQGLSPEEMARVRAQNSSGVMGGPQKMLMPSQ
FPNQGQQGFSGGQGPYQAMSQDMGNTQDMFSPDQSSMPMSNVGTTRLSHMPLPPASNPPG
TVHSAPNRGLGRRPSDLTISINQMGSPGMGHLKSPTLSQVHSPLVTSPSANLKSPQTPSQ
MVPLPSANPPGPLKSPQVLGSSLSVRSPTGSPSRLKSPSMAVPSPGWVASPKTAMPSPGV
SQNKQPPLNMNSSTTLSNMEQGTLPPSGPRSSSSAPPANPPSGLMNPSLPFTSSPDPTPS
QNPLSLMMTQMSKYAMPSSTPLYHNAIKTIATSDDELLPDRPLLPPPPPPQGSGPGISNS
QPSQMHLNSAAAQSPMGMNLPGQQPLSHEPPPAMLPSPTPLGSNIPLHPNAQGTGGPPQN
SMMMAPGGPDSLNAPCGPVPSSSQMMPFPPRLQQPHGAMAPTGGGGGGPGLQQHYPSGMA
LPPEDLPNQPPGPMPPQQHLMGKAMAGRMGDAYPPGVLPGVASVLNDPELSEVIRPTPTG
IPEFDLSRIIPSEKPSSTLQYFPKSENQPPKAQPPNLHLMNLQNMMAEQTPSRPPNLPGQ
QGVQRGLNMSMCHPGQMSLLGRTGVPPQQGMVPHGLHQGVMSPPQGLMTQQNFMLMKQRG
VGGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQMGYLPAPGGMANLPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UU0	0.999	0.999	0.000	1499	1.000	1.000	Q86UU0.pdb.gz	BCL9L_HUMAN B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1
2	AFDB:F1R405	0.087	0.084	2.401E-47	1573	0.376	0.359	F1R405.pdb.gz	F1R405_DANRE B-cell CLL/lymphoma 9 protein isoform X1 OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
3	AFDB:O00512	0.059	0.061	2.068E-44	1426	0.350	0.368	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
4	AFDB:Q7TPM1	0.039	0.040	2.975E-6	1486	0.175	0.177	Q7TPM1.pdb.gz	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
5	AFDB:Q6ZU65	0.035	0.038	1.534E-5	1347	0.153	0.171	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
6	AFDB:Q961D9	0.047	0.048	2.593E-5	1469	0.165	0.168	Q961D9.pdb.gz	BCL9_DROME Protein BCL9 homolog OS=Drosophila melanogaster OX=7227 GN=lgs PE=1 SV=1
7	AFDB:Q99700	0.039	0.043	3.372E-5	1313	0.159	0.181	Q99700.pdb.gz	ATX2_HUMAN Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
8	AFDB:A0A0B4K682	0.035	0.036	3.579E-4	1315	0.116	0.132	A0A0B4K682.pdb.gz	A0A0B4K682_DROME Javelin-like, isoform D OS=Drosophila melanogaster OX=7227 GN=jvl PE=4 SV=1
9	AFDB:Q8IY92	0.045	0.039	1.330E-3	1834	0.175	0.143	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
10	AFDB:D4A702	0.043	0.047	4.057E-3	1262	0.147	0.174	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
11	PDB:6n61D	0.016	0.019	7.184	1239	0.004	0.005	6n61D.pdb.gz	Structural mechanism of transcription inhibition by lasso peptides microcin J25 and capistruin.
12	PDB:7o9kI	0.022	0.103	7.671	212	0.009	0.066	7o9kI.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
13	PDB:7wtww	0.017	0.078	8.191	332	0.007	0.033	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZX0	0.0	2833	1462	0.975	1.000	A0A087WZX0_HUMAN BCL9 like OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1
2	Q67FY2	0.0	2356	1494	0.927	0.930	BCL9L_MOUSE B-cell CLL/lymphoma 9-like protein OS=Mus musculus OX=10090 GN=Bcl9l PE=1 SV=1
3	Q67FY3	0.0	726	1530	0.471	0.461	BCL9L_DANRE B-cell CLL/lymphoma 9-like protein OS=Danio rerio OX=7955 GN=bcl9l PE=2 SV=1
4	Q86UU0	0.0	2906	1499	1.000	1.000	BCL9L_HUMAN B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1
5	Q67FY0	1.08e-131	446	1474	0.377	0.383	Q67FY0_DANRE B-cell CLL/lymphoma 9 protein OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
6	O00512	1.54e-127	434	1426	0.306	0.321	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
7	Q9D219	3.37e-124	424	1425	0.312	0.328	BCL9_MOUSE B-cell CLL/lymphoma 9 protein OS=Mus musculus OX=10090 GN=Bcl9 PE=1 SV=3
8	F1R405	2.74e-95	342	1573	0.292	0.278	F1R405_DANRE B-cell CLL/lymphoma 9 protein isoform X1 OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
9	A0A8I5ZUN3	0.085	40.0	35375	0.073	0.003	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11502 BCL9	1.3e-11	55.4	B-cell lymphoma 9 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335320

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.998	Catenin beta-1
2	9606.ENSP00000357442	0.967	Pygopus homolog 2
3	9606.ENSP00000381382	0.929	Transcription factor 4
4	9606.ENSP00000234739	0.922	B-cell CLL/lymphoma 9 protein
5	9606.ENSP00000392466	0.908	LIM domain-binding protein 1
6	9606.ENSP00000365682	0.906	Transducin-like enhancer protein 1
7	9606.ENSP00000452871	0.904	Transducin-like enhancer protein 3
8	9606.ENSP00000365720	0.903	Transducin-like enhancer protein 4
9	9606.ENSP00000434024	0.902	Histone H2AX
10	9606.ENSP00000274764	0.900	Histone H2B type 1-A
11	9606.ENSP00000289316	0.900	Histone H2B type 1-D
12	9606.ENSP00000296417	0.900	Histone H2A.Z
13	9606.ENSP00000308405	0.900	Histone H2A.V
14	9606.ENSP00000328484	0.900	Histone H2A type 1-J
15	9606.ENSP00000332194	0.900	Histone H2A type 2-C
16	9606.ENSP00000341094	0.900	Histone H2A type 1-D
17	9606.ENSP00000349430	0.900	Histone H2B type 1-K
18	9606.ENSP00000355657	0.900	Histone H3.1t
19	9606.ENSP00000358151	0.900	Histone H2B type 2-E
20	9606.ENSP00000366618	0.900	Histone H2B type 1-L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	1.000	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0019222	0.980	regulation of metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0009889	0.964	regulation of biosynthetic process
GO:0048518	0.963	positive regulation of biological process
GO:0051252	0.963	regulation of RNA metabolic process
GO:0010468	0.957	regulation of gene expression
GO:0006355	0.952	regulation of DNA-templated transcription
GO:0048522	0.945	positive regulation of cellular process
GO:0045944	0.940	positive regulation of transcription by RNA polymerase II
GO:0009987	0.911	cellular process
GO:0048523	0.859	negative regulation of cellular process
GO:0048583	0.744	regulation of response to stimulus
GO:0009966	0.727	regulation of signal transduction
GO:0050896	0.592	response to stimulus
GO:0044238	0.529	primary metabolic process
GO:0071704	0.501	organic substance metabolic process
GO:0051716	0.459	cellular response to stimulus
GO:0032502	0.430	developmental process
GO:0048856	0.414	anatomical structure development
GO:0048585	0.377	negative regulation of response to stimulus
GO:0006807	0.355	nitrogen compound metabolic process
GO:0050793	0.352	regulation of developmental process
GO:0009968	0.340	negative regulation of signal transduction
GO:0044237	0.315	cellular metabolic process
GO:0045595	0.314	regulation of cell differentiation
GO:0023052	0.306	signaling
GO:0007154	0.306	cell communication
GO:0032501	0.305	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.986	intracellular organelle lumen
GO:0005654	0.982	nucleoplasm
GO:0043232	0.916	intracellular non-membrane-bounded organelle
GO:0032991	0.841	protein-containing complex
GO:0005730	0.770	nucleolus
GO:0005737	0.601	cytoplasm
GO:0140513	0.551	nuclear protein-containing complex
GO:0090575	0.423	RNA polymerase II transcription regulator complex
GO:1990907	0.403	beta-catenin-TCF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]