StarFunc result for job id Q86UU1

User Input

>input (1377 residues)
MDALNRNQIGPGCQTQTMVQKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHTPQTATRGP
SACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPG
AMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPSVPPLVPARSSSYHLALQPPQ
SRPSGARSESPRLSRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESPRLGGQLPVVA
ISLSEYPASGALSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFREPPGSERVLTTSP
SRQLVGRTFSDGLATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPTRTTPDP
KLNREVAESPRPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPHKGSFSGRLSP
AYSLGSLTGASPCQSPCVQRKLSSGDLRVPVTRERKNSITEISDNEDDLLEYHRRQRQER
LREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGRRPSRGLAGA
SGRSSEEPGVATQRLWESMERSDEENLKEECSSTESTQQEHEDAPSTKLQGEVLALEEER
AQVLGHVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQKAVDQLQEKL
VALETGIQKERDKEAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKAELLRS
IAKRKERLAILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGG
RPFPKTTSTLKEMEKLLLPAVDLEQWYQELMAGLGTGPAAASPHSSPPPLPAKASRQLQV
YRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNGTGSLPR
NLAATLQDIETKRQLALQQKGQQVIEEQRRRLAELKQKAAAEAQCQWDALHGAAPFPAGP
SGFPPLMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMETSISTGGNSACSPDNMSSA
SGLDMGKIEEMEKMLKEAHAEKNRLMESREREMELRRQALEEERRRREQVERRLQSESAR
RQQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCR
GYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAK
KRFFRFTMVTESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UU1	1.000	1.000	0.000	1377	1.000	1.000	Q86UU1.pdb.gz	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
2	PDB:7wrgA	0.065	0.109	2.385E-6	812	0.020	0.033	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
3	PDB:7wrgB	0.066	0.115	1.057E-5	783	0.018	0.032	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
4	PDB:6bbpA	0.054	0.139	1.318E-5	520	0.020	0.052	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
5	AFDB:M9PEK8	0.044	0.058	1.326E-5	933	0.115	0.170	M9PEK8.pdb.gz	M9PEK8_DROME Ensconsin, isoform I OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
6	PDB:3ljuX	0.064	0.222	1.737E-5	373	0.018	0.067	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	PDB:2ff4A	0.064	0.223	2.165E-5	379	0.014	0.050	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
8	AFDB:Q6P9L3	0.066	0.079	2.432E-5	1114	0.115	0.142	Q6P9L3.pdb.gz	Q6P9L3_MOUSE Bptf protein OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
9	PDB:6u3eA	0.056	0.185	4.198E-5	397	0.020	0.068	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
10	PDB:2kb3A	0.063	0.530	4.687E-5	143	0.015	0.140	2kb3A.pdb.gz
11	AFDB:P34333	0.057	0.045	1.345E-4	1778	0.123	0.095	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
12	PDB:4mk0A	0.062	0.129	1.493E-4	631	0.015	0.032	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
13	PDB:7dvqX	0.062	0.493	1.577E-4	156	0.009	0.077	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:4iapA	0.053	0.269	1.667E-4	256	0.015	0.082	4iapA.pdb.gz
15	AFDB:O96685	0.066	0.071	3.075E-4	1261	0.082	0.090	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
16	AFDB:A8JNK1	0.037	0.041	6.299E-4	1241	0.138	0.153	A8JNK1.pdb.gz	A8JNK1_DROME Ensconsin, isoform F OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
17	AFDB:Q9VED3	0.038	0.043	8.299E-4	1186	0.113	0.132	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
18	AFDB:A0A0B4KI34	0.042	0.060	1.035E-3	941	0.088	0.129	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
19	AFDB:B7SY83	0.064	0.060	1.290E-3	1477	0.110	0.103	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
20	AFDB:D3Z8E6	0.057	0.049	1.363E-3	1604	0.131	0.112	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86SQ0	0.0	600	1253	0.282	0.310	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
2	Q86UU1	0.0	2774	1377	1.000	1.000	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
3	Q8K1N2	0.0	589	1249	0.245	0.271	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
4	E9PFQ4	1.47e-132	439	1115	0.222	0.274	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
5	Q6NSJ2	5.99e-55	206	640	0.066	0.142	PHLB3_HUMAN Pleckstrin homology-like domain family B member 3 OS=Homo sapiens OX=9606 GN=PHLDB3 PE=1 SV=3
6	Q96L93	5.49e-23	109	1317	0.037	0.039	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
7	B1AVY7	5.01e-22	106	1312	0.037	0.039	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
8	Q9P2P6	2.87e-17	90.9	4700	0.038	0.011	STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens OX=9606 GN=STARD9 PE=1 SV=3
9	Q9VB25	9.63e-15	82.4	1265	0.033	0.036	KL98A_DROME Kinesin-like protein Klp98A OS=Drosophila melanogaster OX=7227 GN=Klp98A PE=1 SV=2
10	L0N7N1	1.26e-12	75.5	1674	0.030	0.024	KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus OX=10090 GN=Kif14 PE=1 SV=1
11	Q15058	4.32e-12	73.6	1648	0.031	0.026	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
12	Q5AVY3	3.29e-11	70.9	1630	0.030	0.025	Q5AVY3_EMENI Kinesin family protein (AFU_orthologue AFUA_2G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=uncA PE=3 SV=1
13	O60333	5.83e-09	63.5	1816	0.035	0.026	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
14	O43896	6.60e-09	63.2	1103	0.025	0.031	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
15	Q9H1H9	8.03e-09	63.2	1805	0.031	0.024	KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2
16	F1QJ64	1.05e-08	62.4	1161	0.030	0.035	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
17	O35787	1.08e-08	62.4	1097	0.025	0.031	KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus OX=10116 GN=Kif1c PE=1 SV=1
18	O35071	1.13e-08	62.4	1100	0.025	0.031	KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2
19	Q9NQT8	1.44e-08	62.4	1826	0.030	0.022	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
20	R4JU55	1.44e-08	62.0	1540	0.028	0.025	R4JU55_XENLA Nuclear and meiotic actin-bundling kinesin OS=Xenopus laevis OX=8355 GN=NabKin PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	1.4e+02	14.2	FHA domain
2	PF00169 PH	9e-11	53.6	PH domain
3	PF15413 PH_11	1	21.2	Pleckstrin homology domain
4	PF14593 PH_3	1.7e+02	13.6	PH domain
5	PF15409 PH_8	0.48	22.1	Pleckstrin homology domain
6	PF14077 WD40_alt	59	15.0	Alternative WD40 repeat motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354498

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353332	0.800	Regulator of telomere elongation helicase 1
2	9606.ENSP00000309572	0.607	Telomerase reverse transcriptase
3	9606.ENSP00000276925	0.602	Cyclin-dependent kinase 4 inhibitor B
4	9606.ENSP00000264029	0.587	Trehalase
5	9606.ENSP00000268616	0.576	Zinc finger CCHC domain-containing protein 14
6	9606.ENSP00000234313	0.571	Pleckstrin
7	9606.ENSP00000319482	0.569	DCN1-like protein 3
8	9606.ENSP00000296955	0.567	Discoidin, CUB and LCCL domain containing 1
9	9606.ENSP00000311360	0.562	Cell cycle checkpoint control protein RAD9A
10	9606.ENSP00000478600	0.560	Prolyl 3-hydroxylase 3
11	9606.ENSP00000257910	0.527	Tetraspanin-31
12	9606.ENSP00000360107	0.519	EF-hand domain-containing protein 1
13	9606.ENSP00000315635	0.518	In neurons, modulates the degradation of NMDA receptor GRIN2B subunit. Plays a role in the regulation of neuronal excitability.
14	9606.ENSP00000355568	0.517	Interferon regulatory factor 2-binding protein 2
15	9606.ENSP00000386597	0.502	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048518	0.973	positive regulation of biological process
GO:0048522	0.962	positive regulation of cellular process
GO:0009987	0.837	cellular process
GO:0051128	0.815	regulation of cellular component organization
GO:0051130	0.491	positive regulation of cellular component organization
GO:0033043	0.467	regulation of organelle organization
GO:0044087	0.429	regulation of cellular component biogenesis
GO:0044089	0.410	positive regulation of cellular component biogenesis
GO:0051493	0.407	regulation of cytoskeleton organization
GO:1903055	0.319	positive regulation of extracellular matrix organization
GO:0010470	0.315	regulation of gastrulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045171	1.000	intercellular bridge
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.720	nucleus
GO:0070013	0.578	intracellular organelle lumen
GO:0031981	0.541	nuclear lumen
GO:0005654	0.491	nucleoplasm
GO:0043232	0.326	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]