StarFunc result for job id Q86UU9

User Input

>input (113 residues)
MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKA
SQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UU9	1.000	1.000	1.322E-16	113	1.000	1.000	Q86UU9.pdb.gz	TKN4_HUMAN Tachykinin-4 OS=Homo sapiens OX=9606 GN=TAC4 PE=1 SV=1
2	AFDB:Q1PDM1	0.163	0.131	1.863	192	0.133	0.078	Q1PDM1.pdb.gz	Q1PDM1_ARATH Microspore-specific promoter 2 OS=Arabidopsis thaliana OX=3702 GN=MSP2 PE=2 SV=1
3	AFDB:Q9AT61	0.154	0.077	2.454	268	0.097	0.041	Q9AT61.pdb.gz	LBD13_ARATH LOB domain-containing protein 13 OS=Arabidopsis thaliana OX=3702 GN=LBD13 PE=1 SV=2
4	AFDB:Q95R62	0.149	0.036	3.017	634	0.168	0.030	Q95R62.pdb.gz	Q95R62_DROME SD04822p OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=2 SV=1
5	AFDB:P02929	0.134	0.071	3.973	239	0.124	0.059	P02929.pdb.gz	TONB_ECOLI Protein TonB OS=Escherichia coli (strain K12) OX=83333 GN=tonB PE=1 SV=2
6	AFDB:Q8I2D6	0.188	0.087	5.233	347	0.080	0.026	Q8I2D6.pdb.gz	Q8I2D6_PLAF7 Exported protein family 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0114200 PE=4 SV=1
7	AFDB:Q9P794	0.141	0.101	5.233	182	0.124	0.077	Q9P794.pdb.gz	RU1C_SCHPO U1 small nuclear ribonucleoprotein C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp103 PE=1 SV=1
8	AFDB:Q9FL69	0.160	0.053	6.006	483	0.195	0.046	Q9FL69.pdb.gz	AGD5_ARATH ADP-ribosylation factor GTPase-activating protein AGD5 OS=Arabidopsis thaliana OX=3702 GN=AGD5 PE=1 SV=1
9	AFDB:F8W1E5	0.152	0.120	6.434	155	0.115	0.084	F8W1E5.pdb.gz	F8W1E5_HUMAN Rac GTPase activating protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1
10	AFDB:Q09769	0.158	0.029	6.434	1067	0.124	0.013	Q09769.pdb.gz	LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pim1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86UU9	2.39e-77	225	113	1.000	1.000	TKN4_HUMAN Tachykinin-4 OS=Homo sapiens OX=9606 GN=TAC4 PE=1 SV=1
2	Q99N14	2.92e-18	76.3	128	0.407	0.359	TKN4_MOUSE Tachykinin-4 OS=Mus musculus OX=10090 GN=Tac4 PE=1 SV=1
3	Q8CH01	3.81e-16	71.6	170	0.381	0.253	TKN4_RAT Tachykinin-4 OS=Rattus norvegicus OX=10116 GN=Tac4 PE=1 SV=1
4	P20366	0.46	31.2	129	0.301	0.264	TKN1_HUMAN Protachykinin-1 OS=Homo sapiens OX=9606 GN=TAC1 PE=1 SV=1
5	Q9QYW4	0.91	30.8	440	0.195	0.050	Q9QYW4_RAT Growth/differentiation factor 9 OS=Rattus norvegicus OX=10116 GN=Gdf9 PE=3 SV=1
6	P41539	2.3	28.9	130	0.204	0.177	TKN1_MOUSE Protachykinin-1 OS=Mus musculus OX=10090 GN=Tac1 PE=2 SV=1
7	P06767	2.5	28.9	130	0.204	0.177	TKN1_RAT Protachykinin-1 OS=Rattus norvegicus OX=10116 GN=Tac1 PE=2 SV=2
8	O16267	5.7	28.1	186	0.150	0.091	O16267_CAEEL Conserved secreted protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F40A3.1 PE=4 SV=2
9	Q9Z0X3	5.7	28.5	440	0.186	0.048	Q9Z0X3_RAT Growth/differentiation factor 9 OS=Rattus norvegicus OX=10116 GN=Gdf9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303522	0.975	Substance-P receptor
2	9606.ENSP00000321106	0.934	Protachykinin-1
3	9606.ENSP00000362403	0.820	Substance-K receptor
4	9606.ENSP00000384400	0.804	Choline/ethanolamine kinase
5	9606.ENSP00000303325	0.786	Neuromedin-K receptor
6	9606.ENSP00000483110	0.720	Tachykinin-3
7	9606.ENSP00000219301	0.562	Serine protease 54
8	9606.ENSP00000330070	0.545	Neuropeptide W
9	9606.ENSP00000248072	0.507	Olfactory receptor 7C2
10	9606.ENSP00000362784	0.505	Olfactory receptor 5C1
11	9606.ENSP00000414909	0.502	Uncharacterized protein C1orf167

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031837	1.000	substance K receptor binding
GO:0031835	1.000	substance P receptor binding
GO:0048018	1.000	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0009582	0.985	detection of abiotic stimulus
GO:2000241	0.982	regulation of reproductive process
GO:0060295	0.981	regulation of cilium movement involved in cell motility
GO:0007186	0.978	G protein-coupled receptor signaling pathway
GO:2000147	0.972	positive regulation of cell motility
GO:0032501	0.968	multicellular organismal process
GO:0007204	0.967	positive regulation of cytosolic calcium ion concentration
GO:2000243	0.966	positive regulation of reproductive process
GO:0051240	0.963	positive regulation of multicellular organismal process
GO:0050951	0.953	sensory perception of temperature stimulus
GO:0044057	0.950	regulation of system process
GO:0051931	0.942	regulation of sensory perception
GO:0016048	0.942	detection of temperature stimulus
GO:0019233	0.930	sensory perception of pain
GO:0051930	0.927	regulation of sensory perception of pain
GO:0008217	0.910	regulation of blood pressure
GO:0050906	0.893	detection of stimulus involved in sensory perception
GO:0062149	0.556	detection of stimulus involved in sensory perception of pain
GO:0031646	0.555	positive regulation of nervous system process
GO:1902093	0.477	positive regulation of flagellated sperm motility
GO:0007217	0.470	tachykinin receptor signaling pathway
GO:0045776	0.461	negative regulation of blood pressure
GO:0003073	0.452	regulation of systemic arterial blood pressure
GO:0048519	0.446	negative regulation of biological process
GO:1904058	0.364	positive regulation of sensory perception of pain
GO:0050965	0.364	detection of temperature stimulus involved in sensory perception of pain
GO:0003085	0.329	negative regulation of systemic arterial blood pressure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]