StarFunc result for job id Q86UV5

User Input

>input (1035 residues)
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAAVKGSDGFWVGKSSLR
SWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCIS
ENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTSL
PNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGG
LMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKL
CPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPD
GEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKI
QIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV
CMPEEGFKGTGLLGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EY58	0.871	0.828	0.000	1092	0.701	0.665	E7EY58.pdb.gz
2	AFDB:Q76LT8	0.961	0.961	0.000	1036	0.945	0.944	Q76LT8.pdb.gz	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
3	AFDB:Q9SCJ9	0.508	0.495	8.937E-73	1067	0.252	0.245	Q9SCJ9.pdb.gz	UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 26 OS=Arabidopsis thaliana OX=3702 GN=UBP26 PE=1 SV=3
4	AFDB:Q57X20	0.374	0.298	7.456E-38	1419	0.203	0.148	Q57X20.pdb.gz	Q57X20_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.250 PE=4 SV=1
5	AFDB:Q8BY87	0.304	0.234	1.163E-31	1376	0.173	0.130	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
6	AFDB:Q24574	0.306	0.208	9.328E-31	1556	0.176	0.117	Q24574.pdb.gz	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
7	AFDB:Q22240	0.296	0.234	1.210E-30	1326	0.175	0.137	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
8	AFDB:Q9FPT1	0.303	0.282	3.708E-28	1116	0.169	0.157	Q9FPT1.pdb.gz	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
9	AFDB:Q9UTT1	0.309	0.284	5.623E-28	1129	0.146	0.134	Q9UTT1.pdb.gz	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
10	AFDB:Q9UPU5	0.293	0.119	7.294E-28	2620	0.119	0.047	Q9UPU5.pdb.gz	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
11	PDB:7yxxA	0.288	0.174	1.252E-24	1754	0.103	0.061	7yxxA.pdb.gz
12	PDB:5cvnB	0.262	0.794	1.372E-23	321	0.090	0.290	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:3mhsA	0.255	0.548	9.791E-22	455	0.091	0.207	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
14	PDB:5k16B	0.249	0.719	1.254E-20	328	0.091	0.287	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:8a9kD	0.234	0.807	1.448E-19	285	0.077	0.281	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
16	PDB:7ay1D	0.259	0.747	3.329E-19	341	0.084	0.255	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
17	PDB:4fjcE	0.233	0.520	5.251E-18	434	0.082	0.196	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
18	PDB:7w3ax	0.253	0.507	5.186E-17	494	0.086	0.180	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
19	PDB:4wa6D	0.228	0.533	1.075E-16	415	0.087	0.217	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
20	PDB:5k1bA	0.218	0.776	8.617E-16	264	0.082	0.322	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IB93	0.0	1517	1047	0.703	0.695	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
2	Q76LT8	0.0	2024	1036	0.938	0.937	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
3	Q86UV5	0.0	2157	1035	1.000	1.000	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
4	E9PJH5	1.34e-90	287	135	0.130	1.000	E9PJH5_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
5	Q9SCJ9	1.53e-83	295	1067	0.197	0.191	UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 26 OS=Arabidopsis thaliana OX=3702 GN=UBP26 PE=1 SV=3
6	Q9UTT1	1.74e-37	155	1129	0.113	0.104	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
7	I3ISS5	6.05e-37	153	1103	0.105	0.099	I3ISS5_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
8	Q93009	1.16e-35	149	1102	0.098	0.092	UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2
9	Q9FPT1	1.17e-35	149	1116	0.111	0.103	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
10	Q4VSI4	1.38e-35	149	1103	0.098	0.092	UBP7_RAT Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Usp7 PE=1 SV=1
11	Q8BY87	2.01e-35	149	1376	0.117	0.088	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
12	Q6A4J8	2.34e-35	148	1103	0.098	0.092	UBP7_MOUSE Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus OX=10090 GN=Usp7 PE=1 SV=1
13	Q84WU2	3.78e-35	147	1115	0.110	0.102	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
14	F1QUS9	9.70e-35	146	1110	0.105	0.098	F1QUS9_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
15	Q9VYQ8	2.15e-34	145	1129	0.098	0.089	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
16	Q70CQ2	2.24e-33	142	3546	0.112	0.033	UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2
17	Q96K76	5.85e-33	140	1375	0.115	0.087	UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3
18	O00507	8.70e-33	140	2555	0.100	0.041	USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens OX=9606 GN=USP9Y PE=2 SV=2
19	P50101	1.04e-32	140	1230	0.098	0.082	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
20	Q9UPU5	1.04e-32	140	2620	0.111	0.044	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06337 DUSP	0.00016	33.6	DUSP domain
2	PF00240 ubiquitin	0.72	21.0	Ubiquitin family
3	PF00443 UCH	3e-40	150.1	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	1.4e-12	59.5	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309262

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.851	TNF receptor-associated factor 2
2	9606.ENSP00000313454	0.829	Ubiquitin-like modifier-activating enzyme 6
3	9606.ENSP00000384273	0.766	Transcription factor p65
4	9606.ENSP00000361658	0.750	Nucleoporin NUP188 homolog
5	9606.ENSP00000453854	0.682	Selenocysteine insertion sequence-binding protein 2-like
6	9606.ENSP00000390625	0.663	Heterogeneous nuclear ribonucleoprotein L-like
7	9606.ENSP00000229268	0.630	Ubiquitin carboxyl-terminal hydrolase 5
8	9606.ENSP00000257548	0.622	Ubiquitin carboxyl-terminal hydrolase 30
9	9606.ENSP00000366819	0.609	Ubiquitin carboxyl-terminal hydrolase isozyme L3
10	9606.ENSP00000353741	0.597	Eukaryotic peptide chain release factor subunit 1
11	9606.ENSP00000360532	0.586	Cell division cycle 5-like protein
12	9606.ENSP00000413035	0.575	RNA binding protein fox-1 homolog 2
13	9606.ENSP00000401721	0.569	PAN2-PAN3 deadenylation complex catalytic subunit PAN2
14	9606.ENSP00000373696	0.556	E3 ubiquitin-protein ligase TRIP12
15	9606.ENSP00000363827	0.548	Basement membrane-specific heparan sulfate proteoglycan core protein
16	9606.ENSP00000312981	0.541	U4/U6.U5 tri-snRNP-associated protein 2
17	9606.ENSP00000263966	0.534	Ubiquitin carboxyl-terminal hydrolase 13
18	9606.ENSP00000413520	0.534	Protein HID1
19	9606.ENSP00000423390	0.517	Ubiquitin carboxyl-terminal hydrolase 26
20	9606.ENSP00000216039	0.516	Josephin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	0.999	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1904888	0.898	cranial skeletal system development
GO:0071704	0.680	organic substance metabolic process
GO:0044238	0.658	primary metabolic process
GO:0006807	0.642	nitrogen compound metabolic process
GO:0043170	0.632	macromolecule metabolic process
GO:1901564	0.614	organonitrogen compound metabolic process
GO:0019538	0.601	protein metabolic process
GO:0009987	0.574	cellular process
GO:0043412	0.540	macromolecule modification
GO:0036211	0.484	protein modification process
GO:0070647	0.401	protein modification by small protein conjugation or removal
GO:0006508	0.389	proteolysis
GO:0050789	0.386	regulation of biological process
GO:0070646	0.350	protein modification by small protein removal
GO:0016579	0.326	protein deubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.975	membrane
GO:0071944	0.866	cell periphery
GO:0005886	0.810	plasma membrane
GO:0005739	0.725	mitochondrion
GO:0030054	0.679	cell junction
GO:0043228	0.500	non-membrane-bounded organelle
GO:0045202	0.365	synapse
GO:0012505	0.309	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.

[back to server]