StarFunc result for job id Q86UW6

User Input

>input (1770 residues)
MPRRRKNLGGNPFRKTANPKEVVVSSVASREEPTTTLPSMGETKVDQEELFTSISEIFSD
LDPDVVYLMLSECDFKVENAMDCLLELSATDTKIEESSSQSFVASENQVGAAESKIMEKR
PEEESEDSKMDSFLDMQLTEDLDSLIQNAFEKLNSSPDDQVYSFLPSQDVNSFNDSSEFI
NPDSSNMTPIFSTQNMNLNGENLENSGSTLSLNPLPSHSVLNESKCFIKDNTLALESNYP
EDSLLSSSLNVASDSIAGCSSLNQKQKELLESECVEAQFSEAPVDLDASEPQACLNLPGL
DLPGTGGDQKSTRVSDVFLPSEGFNFKPHKHPELPTKGKDVSYCPVLAPLPLLLPPPPPP
PMWNPMIPAFDLFQGNHGFVAPVVTTAAHWRSVNYTFPPSVISHTSPTKVWRNKDGTSAY
QVQETPVSQVVRKKTSYVGLVLVLLRGLPGSGKSFLARTLQEDNPSGVILSTDDYFYING
QYQFDVKYLGEAHEWNQNRAKEAFEKKISPIIIDNTNLQAWEMKPYVALSQKHKYKVLFR
EPDTWWKFKPKELARRNIHGVSKEKITRMLEHYQRFVSVPIIMSSSVPEKIERIELCAYS
CEDRSTSPRDDEDIISEKEENILSLSLKHLEFTEEKNLDVTKETMLPENVAYLSNADLNK
RRKEISDMNPSIQSALILETPHMYFSDSESKLQATDKSENEQIEMVAVKGYSKTDTDSSM
ERVSPSTCCSENNQEDCDLANSGPLQNEKSSPGEIVEERATVTKKAFGKQKSKSTLEKFP
RHELSNFVGDWPVDKTIGQRTKRNRKTEKTSSVQSDKKYNYPQSHKLVNSVSVNTDCVQQ
RGSPHESVEDGRKSQCDDASEPLNSYKYDAYKNIDKNSFNIMGDWPSSDSLAQREHRSRM
PKTGLSEPNLEIGTNDKMNEISLSTAHEACWGTSSQKLKTLGSSNLGSSEMLLSEMTCES
QTCLSKKSHGQHTSLPLTFTNSAPTVSGVVEPQTLAECQEQMPKRDPGKEVGMCTQTEPQ
DFALLWKIEKNKISISDSIKVLTGRLDGFKPKVFNINTKSDVQEAIPYRVMYDKSTFVEE
SELTSADESENLNILCKLFGSFSLEALKDLYERCNKDIIWATSLLLDSETKLCEDTEFEN
FQKSCDGSQIGPFSLGLNLKEIISQRGTLENSNSPVPEFSHGIGISNADSQSTCDAERGN
SEQAEMRAVTPENHESMTSIFPSAAVGLKNNNDILPNSQEELLYSSKQSFPGILKATTPK
DMSETEKNLVVTETGDNIHSPSHFSDIFNFVSSTSNLELNEEIYFTDSLEIKRNENFPKD
YVKFSDEEEFMNEDEKEMKEILMAGSSLSAGVSGEDKTEILNPTPAMAKSLTIDCLELAL
PPELAFQLNELFGPVGIDSGSLTVEDCVVHIDLNLAKVIHEKWKESVMERQRQEEVSCGK
FMQDPSLVGHTGLDNPEQKSSQRTGKKLLKTLTASEMLPLLDHWNTQTKKVSLREIMSEE
IALQEKHNLKRETLMFEKDCATKLKEKQLFKIFPAINQNFLVDIFKDHNYSLEHTVQFLN
CVLEGDPVKTVVAQEFVHQNENVTSHTGQKSKEKKPKKLKETEETPSELSFQDFEYPDYD
DYRAEAFLHQQKRMECYSKAKEAYRIGKKNVATFYAQQGTLHEQKMKEANHLAAIEIFEK
VNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVA
RIKPAVIKYLISHSFRFSEIKPGCLKVMLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VQG7	0.343	0.358	0.000	1678	0.677	0.715	F8VQG7.pdb.gz	F8VQG7_MOUSE NEDD4 binding protein 2 OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=1
2	AFDB:Q86UW6	1.000	1.000	0.000	1770	1.000	1.000	Q86UW6.pdb.gz	N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2 PE=1 SV=2
3	PDB:2ia5H	0.070	0.377	5.041E-6	301	0.020	0.120	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
4	PDB:1k6mA	0.068	0.248	2.937E-4	432	0.013	0.053	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
5	PDB:2axnA	0.069	0.245	5.015E-4	451	0.012	0.047	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
6	PDB:1bifA	0.069	0.258	1.313E-3	432	0.014	0.056	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
7	PDB:5htkA	0.066	0.242	1.627E-3	425	0.017	0.071	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
8	AFDB:B1AYB6	0.031	0.035	2.855E-3	1498	0.115	0.136	B1AYB6.pdb.gz	MBD5_MOUSE Methyl-CpG-binding domain protein 5 OS=Mus musculus OX=10090 GN=Mbd5 PE=2 SV=1
9	PDB:2cdnA	0.063	0.495	5.002E-3	186	0.016	0.151	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
10	AFDB:S6BAK9	0.032	0.040	5.142E-3	1231	0.094	0.135	S6BAK9.pdb.gz
11	PDB:1ko5A	0.065	0.513	5.567E-3	172	0.013	0.134	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
12	PDB:1kagA	0.064	0.501	5.873E-3	158	0.014	0.152	1kagA.pdb.gz
13	PDB:1tevA	0.066	0.466	6.536E-3	194	0.014	0.124	1tevA.pdb.gz
14	PDB:3ch4B	0.047	0.292	9.504E-3	188	0.015	0.138	3ch4B.pdb.gz
15	AFDB:Q8IMC6	0.046	0.058	1.499E-2	1262	0.091	0.128	Q8IMC6.pdb.gz	ASATR_DROME Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2
16	AFDB:Q94FL9	0.039	0.057	2.299E-2	961	0.083	0.153	Q94FL9.pdb.gz	MB3R4_ARATH Transcription factor MYB3R-4 OS=Arabidopsis thaliana OX=3702 GN=MYB3R4 PE=1 SV=1
17	AFDB:E9PYF4	0.036	0.037	3.004E-2	1699	0.120	0.125	E9PYF4.pdb.gz	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
18	AFDB:Q8I5I9	0.031	0.025	3.004E-2	2432	0.115	0.083	Q8I5I9.pdb.gz	Q8I5I9_PLAF7 AP2 domain transcription factor AP2-G OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1222600 PE=4 SV=1
19	AFDB:Q8CFT2	0.033	0.030	3.721E-2	1985	0.109	0.097	Q8CFT2.pdb.gz	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2
20	AFDB:P39060	0.033	0.033	5.129E-2	1754	0.111	0.112	P39060.pdb.gz	COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YUP5	0.0	1955	1498	0.589	0.696	A0A0J9YUP5_MOUSE NEDD4 binding protein 2 (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=3
2	F8VQG7	0.0	2270	1678	0.680	0.718	F8VQG7_MOUSE NEDD4 binding protein 2 OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=1
3	Q69ZK1	0.0	1962	1512	0.592	0.692	Q69ZK1_MOUSE MKIAA1413 protein (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=2 SV=1
4	Q86UW6	0.0	3663	1770	1.000	1.000	N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2 PE=1 SV=2
5	Q8BX85	0.0	986	836	0.308	0.653	Q8BX85_MOUSE NEDD4-binding protein 2-like 2 (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=2 SV=1
6	Q92802	2.13e-49	188	583	0.047	0.144	N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 PE=1 SV=1
7	Q8JZS6	1.89e-48	185	575	0.046	0.141	N42L2_MOUSE NEDD4-binding protein 2-like 2 OS=Mus musculus OX=10090 GN=N4bp2l2 PE=2 SV=2
8	Q9UTP4	2.43e-15	79.0	206	0.028	0.243	YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11H11.03c PE=4 SV=1
9	O64843	1.98e-11	71.2	567	0.029	0.090	CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana OX=3702 GN=CID7 PE=1 SV=1
10	Q08954	1.48e-09	62.8	240	0.026	0.192	YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPL199C PE=1 SV=1
11	K7ERC4	7.42e-08	56.2	164	0.020	0.213	K7ERC4_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=8
12	K7ERZ0	2.18e-07	54.3	153	0.019	0.222	K7ERZ0_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=8
13	P09543	7.66e-07	56.2	421	0.019	0.081	CN37_HUMAN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2
14	C9K0L8	8.78e-07	52.4	144	0.019	0.229	C9K0L8_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2
15	P16330	2.48e-06	54.3	420	0.021	0.088	CN37_MOUSE 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3
16	P13233	3.67e-06	53.9	420	0.020	0.086	CN37_RAT 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Cnp PE=1 SV=2
17	O74840	5.50e-06	53.5	502	0.023	0.080	YCY3_SCHPO Smr domain-containing protein C1235.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1235.03 PE=2 SV=2
18	P06623	1.63e-05	51.6	400	0.019	0.085	CN37_BOVIN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Bos taurus OX=9913 GN=CNP PE=1 SV=2
19	Q584J3	3.22e-05	50.1	265	0.024	0.158	Q584J3_TRYB2 Smr domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.620 PE=4 SV=1
20	P0CB49	0.002	45.8	1376	0.020	0.026	YLPM1_RAT YLP motif-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ylpm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.1e+02	14.7	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	3.9e+02	12.5	AAA domain
3	PF13191 AAA_16	50	15.7	AAA ATPase domain
4	PF13238 AAA_18	2.7	20.0	AAA domain
5	PF13401 AAA_22	1.2e+02	14.4	AAA domain
6	PF13671 AAA_33	1e-08	46.9	AAA domain
7	PF02845 CUE	0.24	22.4	CUE domain
8	PF08590 DUF1771	1.8e-13	61.9	Domain of unknown function (DUF1771)
9	PF02026 RyR	0.18	23.4	RyR domain
10	PF01713 Smr	1.9e-06	39.5	Smr domain
11	PF06414 Zeta_toxin	98	13.8	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261435

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355402	0.770	Immunoglobulin superfamily containing leucine-rich repeat protein 2
2	9606.ENSP00000348673	0.741	Zinc finger protein 770
3	9606.ENSP00000484687	0.724	Zinc finger HIT-type containing 3
4	9606.ENSP00000352271	0.680	DNA repair protein XRCC2
5	9606.ENSP00000243326	0.661	Telomere-associated protein RIF1
6	9606.ENSP00000438284	0.643	cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
7	9606.ENSP00000351346	0.626	Vacuolar protein sorting-associated protein 13B
8	9606.ENSP00000323816	0.609	Aryl hydrocarbon receptor repressor
9	9606.ENSP00000441838	0.608	Zinc finger protein 567
10	9606.ENSP00000369559	0.602	Olfactory receptor 51I1
11	9606.ENSP00000346173	0.592	Electron transfer flavoprotein subunit beta
12	9606.ENSP00000296411	0.568	Methionine aminopeptidase 1
13	9606.ENSP00000355589	0.566	Signal-induced proliferation-associated 1-like protein 2
14	9606.ENSP00000424827	0.540	E3 ubiquitin-protein ligase NEDD4
15	9606.ENSP00000428756	0.533	Double-stranded RNA-binding protein Staufen homolog 2
16	9606.ENSP00000323264	0.524	MARVEL domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.995	catalytic activity
GO:1901363	0.991	heterocyclic compound binding
GO:0097159	0.991	organic cyclic compound binding
GO:0016787	0.986	hydrolase activity
GO:0016788	0.979	hydrolase activity, acting on ester bonds
GO:0005524	0.970	ATP binding
GO:0004518	0.967	nuclease activity
GO:0140097	0.965	catalytic activity, acting on DNA
GO:0004519	0.959	endonuclease activity
GO:0016301	0.958	kinase activity
GO:0019205	0.946	nucleobase-containing compound kinase activity
GO:0016773	0.932	phosphotransferase activity, alcohol group as acceptor
GO:0004536	0.905	deoxyribonuclease activity
GO:0004520	0.899	DNA endonuclease activity
GO:0051734	0.796	polynucleotide kinase activity
GO:0046404	0.713	polydeoxyribonucleotide 5'-hydroxyl-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0009987	0.982	cellular process
GO:0050794	0.940	regulation of cellular process
GO:0071704	0.889	organic substance metabolic process
GO:0044238	0.811	primary metabolic process
GO:0071840	0.735	cellular component organization or biogenesis
GO:0016043	0.730	cellular component organization
GO:0006807	0.705	nitrogen compound metabolic process
GO:0044237	0.694	cellular metabolic process
GO:0019222	0.533	regulation of metabolic process
GO:0048519	0.514	negative regulation of biological process
GO:0060255	0.513	regulation of macromolecule metabolic process
GO:0050896	0.506	response to stimulus
GO:0043170	0.490	macromolecule metabolic process
GO:0010468	0.441	regulation of gene expression
GO:0032502	0.423	developmental process
GO:0051171	0.420	regulation of nitrogen compound metabolic process
GO:0080090	0.398	regulation of primary metabolic process
GO:0031323	0.398	regulation of cellular metabolic process
GO:0048523	0.394	negative regulation of cellular process
GO:0019219	0.383	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.381	multicellular organismal process
GO:0048518	0.325	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005634	0.966	nucleus
GO:0016020	0.473	membrane
GO:0012505	0.310	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.986	Hydrolases.
EC:3.1.-.-	0.979	Acting on ester bonds.
EC:2.7.-.-	0.963	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.932	Phosphotransferases with an alcohol group as acceptor.
RHEA:54580	0.796	a 5'-end dephospho-ribonucleoside-RNA + ATP = a 5'-end 5'-monophospho-ribonucleoside-RNA + ADP + H(+)
EC:2.7.1.78	0.796	polynucleotide 5'-hydroxyl-kinase.
RHEA:15669	0.713	a 5'-end dephospho-2'-deoxyribonucleoside-DNA + ATP = a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + ADP + H(+)

[back to server]