StarFunc result for job id Q86UW7

User Input

>input (1296 residues)
MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPS
PSVLSEGRDEPQRQLDDEQERRIRLQLYVFVVRCIAYPFNAKQPTDMARRQQKLNKQQLQ
LLKERFQAFLNGETQIVADEAFCNAVRSYYEVFLKSDRVARMVQSGGCSANDFREVFKKN
IEKRVRSLPEIDGLSKETVLSSWIAKYDAIYRGEEDLCKQPNRMALSAVSELILSKEQLY
EMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGRLQLADKMAKERKFPKFIAKD
MENMYIEELRSSVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLDIGDENEIQLSKSD
VVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGEKLQTDQAEASRPQWGTQGDFTTTHP
RPVVKVKLFTESTGVLALEDKELGRVILYPTSNSSKSAELHRMVVPKNSQDSDLKIKLAV
RMDKPAHMKHSGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELMQLEG
YTVDYTDPHPGLQGGCMFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPVPAIQ
TQKLNPKGGTLHADAQLSGKDADRFQKHGMDEFISANPCKLDHAFLFRILQRQTLDHRLN
DSYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLAELMEHSENGAVIDPTLLHYSFAF
CASHVHGNRPDGIGTVSVEEKERFEEIKERLSSLLENQISHFRYCFPFGRPEGALKATLS
LLERVLMKDIATPIPAEEVKKVVRKCLEKAALINYTRLTEYAKIEETMNQASPARKLEEI
LHLAELCIEVLQQNEEHHAEGREAFAWWPDLLAEHAEKFWALFTVDMDTALEAQPQDSWD
SFPLFQLLNNFLRNDTLLCNGKFHKHLQEIFVPLVVRYVDLMESSIAQSIHRGFEQETWQ
PVKNIANSLPNVALPKVPSLPLNLPQIPNISTASWMPSLYESTNGSATSEDLFWKLDALQ
MFVFDLHWPEQEFAHHLEQRLKLMASDMLEACVKRTRTAFELKLQKASKTTDLRIPASVC
TMFNVLVDAKKQSTKLCALDGGQEQQYHSKIDDLIDNSVKEIISLLVSKFVSVLEGVLSK
LSRYDEGTFFSSILSFTVKAAAKYVDVPKPGMDLADTYIMFVRQNQDILREKVNEEMYIE
KLFDQWYSSSMKVICVWLTDRLDLQLHIYQLKTLIKIVKKTYRDFRLQGVLEGTLNSKTY
DTVHRRLTVEEATASVSEGGGLQGITMKDSDEEEEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q23658	0.814	0.767	0.000	1378	0.484	0.455	Q23658.pdb.gz	CAPS_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=2 SV=6
2	AFDB:Q62717	0.886	0.890	0.000	1289	0.765	0.769	Q62717.pdb.gz	CAPS1_RAT Calcium-dependent secretion activator 1 OS=Rattus norvegicus OX=10116 GN=Cadps PE=1 SV=1
3	AFDB:Q80TJ1	0.896	0.858	0.000	1355	0.789	0.754	Q80TJ1.pdb.gz	CAPS1_MOUSE Calcium-dependent secretion activator 1 OS=Mus musculus OX=10090 GN=Cadps PE=1 SV=3
4	AFDB:Q8BYR5	0.930	0.929	0.000	1297	0.959	0.958	Q8BYR5.pdb.gz	CAPS2_MOUSE Calcium-dependent secretion activator 2 OS=Mus musculus OX=10090 GN=Cadps2 PE=1 SV=2
5	AFDB:Q9NHE5	0.788	0.710	0.000	1447	0.571	0.511	Q9NHE5.pdb.gz	CAPS_DROME Calcium-dependent secretion activator OS=Drosophila melanogaster OX=7227 GN=Cadps PE=1 SV=3
6	AFDB:Q62768	0.304	0.236	6.488E-19	1735	0.133	0.099	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
7	AFDB:P27715	0.289	0.191	1.436E-18	2155	0.125	0.075	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
8	AFDB:Q62769	0.308	0.255	8.937E-18	1622	0.126	0.100	Q62769.pdb.gz	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
9	AFDB:Q9Z1N9	0.283	0.238	1.180E-17	1602	0.123	0.100	Q9Z1N9.pdb.gz	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
10	AFDB:Q9UPW8	0.304	0.241	3.888E-17	1703	0.127	0.096	Q9UPW8.pdb.gz	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
11	PDB:5izrC	0.078	0.148	3.005E-5	659	0.025	0.049	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:5ixcA	0.078	0.143	5.241E-5	684	0.024	0.045	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:5iz5B	0.081	0.137	7.203E-5	746	0.023	0.040	5iz5B.pdb.gz
14	PDB:1xi4A	0.060	0.052	8.115E-5	1630	0.088	0.070	1xi4A.pdb.gz
15	PDB:5iz5A	0.079	0.131	8.444E-5	757	0.023	0.040	5iz5A.pdb.gz
16	PDB:1cjyA	0.082	0.161	1.360E-4	633	0.013	0.027	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	PDB:4rj9A	0.075	0.526	4.139E-4	161	0.012	0.093	4rj9A.pdb.gz
18	PDB:5a52A	0.078	0.552	4.663E-4	154	0.015	0.130	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:5a50A	0.077	0.515	5.049E-4	165	0.013	0.103	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:3nsjA	0.082	0.194	7.220E-4	530	0.014	0.034	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRN7	0.0	1296	776	0.471	0.787	A2RRN7_HUMAN CADPS protein OS=Homo sapiens OX=9606 GN=CADPS PE=1 SV=1
2	F8W8P5	0.0	2462	1194	0.916	0.994	F8W8P5_HUMAN Calcium dependent secretion activator 2 OS=Homo sapiens OX=9606 GN=CADPS2 PE=1 SV=2
3	H0Y8B5	0.0	998	490	0.372	0.984	H0Y8B5_HUMAN Calcium dependent secretion activator 2 (Fragment) OS=Homo sapiens OX=9606 GN=CADPS2 PE=1 SV=1
4	H9G2V2	0.0	1261	1385	0.484	0.453	H9G2V2_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=1 SV=1
5	H9G2V3	0.0	1268	1366	0.484	0.459	H9G2V3_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=1 SV=1
6	Q23658	0.0	1263	1378	0.484	0.455	CAPS_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=2 SV=6
7	Q62717	0.0	1987	1289	0.731	0.735	CAPS1_RAT Calcium-dependent secretion activator 1 OS=Rattus norvegicus OX=10116 GN=Cadps PE=1 SV=1
8	Q80TJ1	0.0	2059	1355	0.755	0.722	CAPS1_MOUSE Calcium-dependent secretion activator 1 OS=Mus musculus OX=10090 GN=Cadps PE=1 SV=3
9	Q86UW7	0.0	2701	1296	1.000	1.000	CAPS2_HUMAN Calcium-dependent secretion activator 2 OS=Homo sapiens OX=9606 GN=CADPS2 PE=1 SV=2
10	Q8BYR5	0.0	2509	1297	0.958	0.957	CAPS2_MOUSE Calcium-dependent secretion activator 2 OS=Mus musculus OX=10090 GN=Cadps2 PE=1 SV=2
11	Q9NHE5	0.0	1462	1447	0.580	0.520	CAPS_DROME Calcium-dependent secretion activator OS=Drosophila melanogaster OX=7227 GN=Cadps PE=1 SV=3
12	Q9ULU8	0.0	2058	1353	0.753	0.721	CAPS1_HUMAN Calcium-dependent secretion activator 1 OS=Homo sapiens OX=9606 GN=CADPS PE=1 SV=3
13	G3MU01	2.54e-13	69.7	110	0.029	0.336	G3MU01_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=4 SV=1
14	Q62769	1.34e-06	55.5	1622	0.048	0.038	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
15	Q9Z1N9	2.43e-06	54.7	1602	0.045	0.036	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
16	O14795	3.79e-06	54.3	1591	0.046	0.037	UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2
17	Q9UPW8	7.86e-05	49.7	1703	0.058	0.044	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
18	Q4KUS2	1.77e-04	48.5	1712	0.056	0.043	UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3
19	Q8NB66	2.04e-04	48.5	2214	0.044	0.026	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
20	Q62768	2.18e-04	48.5	1735	0.056	0.042	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06292 MUN	2.3e-155	529.3	MUN domain
2	PF00169 PH	1.9e-05	36.4	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344087	0.829	Autism susceptibility gene 2 protein
2	9606.ENSP00000361214	0.827	Pro-neuregulin-3, membrane-bound isoform
3	9606.ENSP00000381932	0.772	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
4	9606.ENSP00000332979	0.686	Beta-secretase 2
5	9606.ENSP00000298229	0.652	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
6	9606.ENSP00000420037	0.650	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
7	9606.ENSP00000259335	0.524	Proteasome-associated protein ECM29 homolog
8	9606.ENSP00000429073	0.510	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3
9	9606.ENSP00000385968	0.509	Potassium voltage-gated channel subfamily S member 3
10	9606.ENSP00000294360	0.505	UPF0587 protein C1orf123
11	9606.ENSP00000260323	0.500	Protein unc-13 homolog C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.966	regulation of cellular process
GO:0023052	0.944	signaling
GO:0006887	0.941	exocytosis
GO:0007267	0.912	cell-cell signaling
GO:0048518	0.866	positive regulation of biological process
GO:0023061	0.812	signal release
GO:0048522	0.794	positive regulation of cellular process
GO:0051649	0.788	establishment of localization in cell
GO:0045055	0.691	regulated exocytosis
GO:1903530	0.594	regulation of secretion by cell
GO:0065008	0.514	regulation of biological quality
GO:0050896	0.458	response to stimulus
GO:0051050	0.399	positive regulation of transport
GO:0032501	0.391	multicellular organismal process
GO:0007268	0.367	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0005737	0.986	cytoplasm
GO:0005829	0.952	cytosol
GO:0031982	0.910	vesicle
GO:0016020	0.907	membrane
GO:0071944	0.871	cell periphery
GO:0005886	0.793	plasma membrane
GO:0031410	0.755	cytoplasmic vesicle
GO:0030054	0.752	cell junction
GO:0045202	0.731	synapse
GO:0012505	0.387	endomembrane system
GO:0098978	0.345	glutamatergic synapse
GO:0043232	0.313	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]