StarFunc result for job id Q86V15

User Input

>input (1759 residues)
MDLGTAEGTRCTDPPAGKPAMAPKRKGGLKLNAICAKLSRQVVVEKRADAGSHTEGSPSQ
PRDQERSGPESGAARAPRSEEDKRRAVIEKWVNGEYSEEPAPTPVLGRIAREGLELPPEG
VYMVQPQGCSDEEDHAEEPSKDGGALEEKDSDGAASKEDSGPSTRQASGEASSLRDYAAS
TMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYE
EYIRKLKAGEQLSWPAPSTKTEERVGKEVVGTLPGLRLPSSTAHLETKATILPLPSHSSV
QMQNLVARASKYDFFIQKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMG
GAIAFKTGKVGRPSKYDVRGIQKPGPAKVPPTPSLAPAPLASVPSAPSAPGPGPEPPASL
SFNTPEYLKSTFSKTDSITTGTVSTVKNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHI
HCAYQYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYH
GCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADC
QFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCV
YSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPPSLLGAKDTEHEES
SNDDLVDFSALSSKNSSLSASPTSQQSSASLAAATAATEAGPSATKPPNSKISGLLPQGL
PGSIPLALALSNSGLPTPTPYFPILAGRGSTSLPVGTPSLLGAVSSGSAASATPDTPTLV
ASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVT
PARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNK
MSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCD
GQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKP
PMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLP
ASPLATTSLENAKPQVKPGFLQFQENDPCLATDCKYANKFHFHCLFGNCKYVCKTSGKAE
SHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMRGHYHCLRTGCYFVTNITTKLP
WHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSH
ARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPV
GNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLY
EDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLS
CHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVP
DCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQERGEPAAEGPAPGPPISLDGSL
SLGAEPGSLLFLQSAAAGLGLALGDAGDPGPPDAAAPGPREGAAAAAAAAGESSQEDEEE
ELELPEEEAEDDEDEDDDEDDDDEDDDEDDDDEDLRTDSEESLPEAAAEAAGAGARTPAL
AALAALGAPGPAPTAASSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CWL2	0.260	0.260	0.000	1761	0.907	0.906	Q9CWL2.pdb.gz	CASZ1_MOUSE Zinc finger protein castor homolog 1 OS=Mus musculus OX=10090 GN=Casz1 PE=1 SV=3
2	AFDB:Q9VXJ5	0.041	0.047	2.231E-6	1311	0.107	0.144	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
3	AFDB:Q61602	0.045	0.048	2.267E-5	1583	0.142	0.157	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
4	AFDB:Q7KHG2	0.036	0.046	2.396E-5	1486	0.134	0.159	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
5	AFDB:Q9IA31	0.033	0.035	6.124E-5	1544	0.118	0.134	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
6	AFDB:P19538	0.040	0.048	1.481E-4	1397	0.115	0.145	P19538.pdb.gz	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2
7	AFDB:Q5U0U1	0.042	0.052	2.180E-4	1267	0.113	0.156	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
8	AFDB:A0A2R8QMX9	0.046	0.052	2.304E-4	1443	0.130	0.159	A0A2R8QMX9.pdb.gz
9	AFDB:P10071	0.049	0.052	6.948E-4	1580	0.143	0.159	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
10	AFDB:A0A0R4IKC9	0.041	0.048	7.760E-4	1268	0.098	0.136	A0A0R4IKC9.pdb.gz	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
11	PDB:7zpkC	0.029	0.113	1.239E-1	233	0.011	0.086	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
12	PDB:6gym6	0.024	0.080	2.581	335	0.011	0.057	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
13	PDB:7x39A	0.021	0.172	2.882	128	0.007	0.094	7x39A.pdb.gz
14	PDB:6t9iB	0.032	0.150	3.218	224	0.009	0.067	6t9iB.pdb.gz
15	PDB:2b3tB	0.029	0.100	3.594	300	0.008	0.047	2b3tB.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
16	PDB:7r97A	0.024	0.121	5.005	226	0.005	0.040	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
17	PDB:7ejsB	0.019	0.170	5.289	110	0.003	0.055	7ejsB.pdb.gz
18	PDB:1q67B	0.020	0.126	5.589	161	0.005	0.056	1q67B.pdb.gz
19	PDB:4v8mBU	0.016	0.137	5.907	158	0.003	0.038	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:7dvqv	0.030	0.298	6.242	119	0.005	0.076	7dvqv.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86V15	0.0	3640	1759	1.000	1.000	CASZ1_HUMAN Zinc finger protein castor homolog 1 OS=Homo sapiens OX=9606 GN=CASZ1 PE=1 SV=4
2	Q9CWL2	0.0	3091	1761	0.904	0.903	CASZ1_MOUSE Zinc finger protein castor homolog 1 OS=Mus musculus OX=10090 GN=Casz1 PE=1 SV=3
3	Q7M3M8	9.15e-71	257	793	0.065	0.145	CAS_DROME Transcription factor castor OS=Drosophila melanogaster OX=7227 GN=cas PE=1 SV=2
4	P98169	4.06e-05	50.8	803	0.031	0.067	ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens OX=9606 GN=ZXDB PE=1 SV=2
5	Q2QGD7	1.00e-04	49.7	858	0.029	0.059	ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens OX=9606 GN=ZXDC PE=1 SV=2
6	P98168	1.15e-04	49.7	799	0.021	0.046	ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens OX=9606 GN=ZXDA PE=1 SV=2
7	Q1LYE3	2.09e-04	48.5	623	0.024	0.069	ZN143_DANRE Zinc finger protein 143 OS=Danio rerio OX=7955 GN=znf143 PE=2 SV=2
8	A0A0G2KFP7	4.16e-04	47.8	749	0.032	0.076	A0A0G2KFP7_DANRE Metal regulatory transcription factor 1 isoform X1 OS=Danio rerio OX=7955 GN=MTF-1 PE=4 SV=2
9	A0A0B5H7U7	4.28e-04	47.8	722	0.032	0.079	A0A0B5H7U7_DANRE Metal regulatory transcription factor 1 isoform X2 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
10	P52747	5.42e-04	47.4	638	0.026	0.071	ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143 PE=1 SV=2
11	Q5XIU2	8.01e-04	46.6	638	0.026	0.071	ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus OX=10116 GN=Znf143 PE=2 SV=2
12	O70230	0.001	46.2	638	0.026	0.071	ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus OX=10090 GN=Znf143 PE=1 SV=2
13	Q8IDY5	0.001	45.8	459	0.011	0.044	Q8IDY5_PLAF7 MSP7-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1334300 PE=4 SV=1
14	Q8QGH4	0.001	46.2	593	0.032	0.096	Q8QGH4_DANRE Metal regulatory transcription factor 1 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
15	Q14872	0.008	43.5	753	0.027	0.062	MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens OX=9606 GN=MTF1 PE=1 SV=2
16	Q07243	0.010	43.1	675	0.026	0.067	MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus OX=10090 GN=Mtf1 PE=1 SV=2
17	D3ZBT4	0.013	42.7	675	0.026	0.067	D3ZBT4_RAT Metal-regulatory transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Mtf1 PE=1 SV=1
18	P36508	0.054	40.8	570	0.024	0.075	ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens OX=9606 GN=ZNF76 PE=1 SV=2
19	Q9VI93	0.093	40.0	946	0.022	0.040	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
20	Q8BMU0	0.15	39.3	568	0.023	0.072	ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus OX=10090 GN=Znf76 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366221

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377080	0.910	Zinc finger protein 1 homolog
2	9606.ENSP00000430432	0.712	Histone deacetylase 2
3	9606.ENSP00000381003	0.681	Tetratricopeptide repeat protein 28
4	9606.ENSP00000254579	0.677	Dynein heavy chain domain 1
5	9606.ENSP00000362442	0.662	Rho GTPase-activating protein 40
6	9606.ENSP00000362268	0.660	MICOS complex subunit MIC27
7	9606.ENSP00000428780	0.660	Claudin-23
8	9606.ENSP00000265872	0.649	Cell division cycle and apoptosis regulator protein 1
9	9606.ENSP00000306522	0.639	Calmodulin-binding transcription activator 1
10	9606.ENSP00000262450	0.628	Chromodomain-helicase-DNA-binding protein 5
11	9606.ENSP00000378320	0.572	Tetratricopeptide repeat protein 7A
12	9606.ENSP00000342109	0.569	Serpin A12
13	9606.ENSP00000327716	0.566	Tail-anchored protein insertion receptor WRB
14	9606.ENSP00000331614	0.564	DNA-binding protein Ikaros
15	9606.ENSP00000353224	0.563	Transferrin receptor protein 1
16	9606.ENSP00000386170	0.536	T-box transcription factor TBX20
17	9606.ENSP00000263934	0.515	Kinesin-like protein KIF1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.988	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048522	0.946	positive regulation of cellular process
GO:0080090	0.937	regulation of primary metabolic process
GO:0051171	0.937	regulation of nitrogen compound metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0019219	0.855	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.845	cellular process
GO:0010468	0.838	regulation of gene expression
GO:0010604	0.836	positive regulation of macromolecule metabolic process
GO:0010556	0.835	regulation of macromolecule biosynthetic process
GO:0031326	0.835	regulation of cellular biosynthetic process
GO:0051252	0.835	regulation of RNA metabolic process
GO:0006355	0.828	regulation of DNA-templated transcription
GO:0051173	0.822	positive regulation of nitrogen compound metabolic process
GO:0031325	0.821	positive regulation of cellular metabolic process
GO:0045944	0.740	positive regulation of transcription by RNA polymerase II
GO:0032501	0.532	multicellular organismal process
GO:0048856	0.431	anatomical structure development
GO:0048523	0.326	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.997	cytosol
GO:0005694	0.997	chromosome
GO:0000785	0.985	chromatin
GO:0032991	0.335	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]