StarFunc result for job id Q86V20

User Input

>input (835 residues)
MSGGSQVHIFWGAPIAPLKITVSEDTASLMSVADPWKKIQLLYSQHSLYLKDEKQHKNLE
NYKVPESIGSPDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM
QICGFKSTVPHFTEEEKYQKLLSENKIRDEQPKHQPDICGKNFNTNLFQLGHKCAAVLDL
VCSTEKINIGPEVVQRECVPTEYHEIQNQCLGLFSSNAVDKSRSEAAVRKVSDLKISTDT
EFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAY
ESGQNQAYSLELFSPVCPKTENSRIHINSDKGLEEHTGSQELFSSEDELPPNEIRIELCS
SGILCSQLNTFHKSAIKRSCTSEDKVGQSEALSRVLQVAKKMKLISNGGDSAVEMDRRNV
SEFKSIKKTSLIKNCDSKSQKYNCLVMVLSPCHVKEINIKFGPNSGSKVPLATVTVIDQS
ETKKKVFLWRTAAFWAFTVFLGDIILLTDVVIHEDQWIGETVLQSTFSSQLLNLGSYSSI
QPEEYSSVVSEVVLQDLLAYVSSKHSYLRDLPPRQPQRVNSIDFVELEHLQPDVLVHAVL
RVVDFTILTEAVYSYRGQKQKKVMLTVEQAQDQHYALVLWGPGAAWYPQLQRKKGVVLIK
AQISELAFPITASQKIALNAHSSLKSIFSSLPNIVYTGCAKCGLELETDENRIYKQCFSC
LPFTMKKIYYRPALMTAIDGRHDVCIRVESKLIEKILLNISADCLNRVIVPSSEITYGMV
VADLFHSLLAVSAEPCVLKIQSLFVLDENSYPLQQDFSLLDFYPDIVKHGANARL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86V20	1.000	1.000	0.000	835	1.000	1.000	Q86V20.pdb.gz	SHLD2_HUMAN Shieldin complex subunit 2 OS=Homo sapiens OX=9606 GN=SHLD2 PE=1 SV=1
2	PDB:2i0qA	0.131	0.223	2.884E-7	461	0.060	0.108	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
3	PDB:8d0bA	0.122	0.098	2.516E-6	1116	0.056	0.042	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
4	PDB:6w6wA	0.125	0.117	7.430E-6	905	0.051	0.048	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
5	PDB:7uy5I	0.114	0.166	9.227E-6	528	0.054	0.085	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
6	PDB:7uy7A	0.102	0.146	3.206E-5	552	0.057	0.087	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
7	PDB:7lmaD	0.140	0.508	6.481E-5	187	0.026	0.118	7lmaD.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
8	PDB:7u5cE	0.116	0.087	1.176E-4	1147	0.051	0.037	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
9	PDB:4owwB	0.104	0.713	2.649E-4	107	0.025	0.196	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
10	AFDB:Q8IVE3	0.062	0.045	9.903E-4	1493	0.128	0.072	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
11	PDB:7qxbP	0.107	0.325	6.825E-3	251	0.023	0.076	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
12	PDB:6raw5	0.104	0.147	9.971E-3	576	0.017	0.024	6raw5.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
13	AFDB:Q9GZR1	0.047	0.038	5.748E-2	1112	0.105	0.079	Q9GZR1.pdb.gz	SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2
14	AFDB:O74412	0.058	0.053	6.068E-2	963	0.120	0.104	O74412.pdb.gz	CBF12_SCHPO Transcription factor cbf12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf12 PE=2 SV=1
15	AFDB:Q8BUH8	0.047	0.040	6.068E-2	1037	0.109	0.088	Q8BUH8.pdb.gz	SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus OX=10090 GN=Senp7 PE=1 SV=1
16	AFDB:Q9ZW32	0.052	0.052	7.535E-2	839	0.131	0.130	Q9ZW32.pdb.gz	Q9ZW32_ARATH At2g29510 OS=Arabidopsis thaliana OX=3702 GN=At2g29510 PE=1 SV=1
17	AFDB:A1ZBH7	0.052	0.042	2.918E-1	1218	0.105	0.072	A1ZBH7.pdb.gz	A1ZBH7_DROME Happyhour, isoform A OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
18	AFDB:P38800	0.064	0.051	5.014E-1	1345	0.127	0.079	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
19	AFDB:B0R0I6	0.058	0.027	5.293E-1	2511	0.087	0.029	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
20	AFDB:Q9HCH5	0.058	0.055	5.293E-1	934	0.121	0.108	Q9HCH5.pdb.gz	SYTL2_HUMAN Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86V20	0.0	1725	835	1.000	1.000	SHLD2_HUMAN Shieldin complex subunit 2 OS=Homo sapiens OX=9606 GN=SHLD2 PE=1 SV=1
2	Q763T4	0.97	35.0	382	0.028	0.060	LAD_ASPOZ L-arabinitol 4-dehydrogenase OS=Aspergillus oryzae OX=5062 GN=ladA PE=1 SV=1
3	Q8NHV4	3.2	33.9	660	0.043	0.055	NEDD1_HUMAN Protein NEDD1 OS=Homo sapiens OX=9606 GN=NEDD1 PE=1 SV=1
4	Q5BET8	3.3	33.5	386	0.028	0.060	Q5BET8_EMENI L-arabinitol 4-dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00942 PE=3 SV=1
5	A2QAC0	3.6	33.5	386	0.024	0.052	LAD_ASPNC L-arabinitol 4-dehydrogenase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=ladA PE=1 SV=1
6	Q9W060	9.0	32.3	3535	0.028	0.007	LYST_DROME Lysosomal-trafficking regulator OS=Drosophila melanogaster OX=7227 GN=mv PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15793 FAM35_C	1e-77	271.0	Protein family FAM35, C-terminal
2	PF08857 ParBc_2	3.6e+02	12.7	Putative ParB-like nuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298784

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000424007	0.990	CDNA FLJ26957 fis, clone SLV00486
2	9606.ENSP00000235310	0.988	Mitotic spindle assembly checkpoint protein MAD2B
3	9606.ENSP00000305875	0.977	Uncharacterized protein C20orf196
4	9606.ENSP00000313759	0.674	CST complex subunit CTC1
5	9606.ENSP00000295461	0.660	Magnesium transporter NIPA3
6	9606.ENSP00000409231	0.629	Belongs to the TRAPPC13 family
7	9606.ENSP00000480186	0.623	DNA polymerase delta subunit 2
8	9606.ENSP00000371475	0.620	TP53-binding protein 1
9	9606.ENSP00000351697	0.618	DNA polymerase zeta catalytic subunit
10	9606.ENSP00000382628	0.595	DNA endonuclease RBBP8
11	9606.ENSP00000380762	0.576	CST complex subunit TEN1
12	9606.ENSP00000304102	0.571	COP9 signalosome complex subunit 6
13	9606.ENSP00000310003	0.558	Protein cornichon homolog 2
14	9606.ENSP00000358576	0.518	5' exonuclease Apollo
15	9606.ENSP00000413411	0.518	Zinc finger protein 724

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051053	0.981	negative regulation of DNA metabolic process
GO:0045739	0.979	positive regulation of DNA repair
GO:0010569	0.976	regulation of double-strand break repair via homologous recombination
GO:0010468	0.975	regulation of gene expression
GO:0050778	0.972	positive regulation of immune response
GO:0010628	0.964	positive regulation of gene expression
GO:0045911	0.963	positive regulation of DNA recombination
GO:0051240	0.959	positive regulation of multicellular organismal process
GO:0048585	0.939	negative regulation of response to stimulus
GO:2001021	0.926	negative regulation of response to DNA damage stimulus
GO:0002889	0.919	regulation of immunoglobulin mediated immune response
GO:0050871	0.919	positive regulation of B cell activation
GO:0002714	0.919	positive regulation of B cell mediated immunity
GO:0002639	0.918	positive regulation of immunoglobulin production
GO:0045910	0.916	negative regulation of DNA recombination
GO:2000781	0.916	positive regulation of double-strand break repair
GO:0002891	0.906	positive regulation of immunoglobulin mediated immune response
GO:0051094	0.780	positive regulation of developmental process
GO:0071704	0.704	organic substance metabolic process
GO:0006807	0.666	nitrogen compound metabolic process
GO:0009987	0.651	cellular process
GO:0044238	0.636	primary metabolic process
GO:0044237	0.636	cellular metabolic process
GO:0050896	0.496	response to stimulus
GO:0043170	0.478	macromolecule metabolic process
GO:1901360	0.408	organic cyclic compound metabolic process
GO:0046483	0.408	heterocycle metabolic process
GO:0006725	0.408	cellular aromatic compound metabolic process
GO:0034641	0.408	cellular nitrogen compound metabolic process
GO:0044260	0.401	cellular macromolecule metabolic process
GO:0006139	0.399	nucleobase-containing compound metabolic process
GO:2000042	0.387	negative regulation of double-strand break repair via homologous recombination
GO:0045830	0.387	positive regulation of isotype switching
GO:0006259	0.371	DNA metabolic process
GO:2001034	0.352	positive regulation of double-strand break repair via nonhomologous end joining
GO:0006950	0.349	response to stress
GO:0051716	0.349	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0035861	0.999	site of double-strand break
GO:0005654	0.954	nucleoplasm
GO:0005737	0.712	cytoplasm
GO:0032991	0.572	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]