StarFunc result for job id Q86V21

User Input

>input (672 residues)
MSKEERPGREEILECQVMWEPDSKKNTQMDRFRAAVGAACGLALESYDDLYHWSVESYSD
FWAEFWKFSGIVFSRVYDEVVDTSKGIADVPEWFKGSRLNYAENLLRHKENDRVALYIAR
EGKEEIVKVTFEELRQEVALFAAAMRKMGVKKGDRVVGYLPNSEHAVEAMLAAASIGAIW
SSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVIP
YVSSRENIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCM
VHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTVGWMMWNWMVSLLATGAAMVLYDGSPLV
PTPNVLWDLVDRIGITVLVTGAKWLSVLEEKAMKPVETHSLQMLHTILSTGSPLKAQSYE
YVYRCIKSSILLGSISGGTDIISCFMGHNFSLPVYKGEIQARNLGMAVEAWNEEGKAVWG
ESGELVCTKPIPCQPTHFWNDENGNKYRKAYFSKFPGIWAHGDYCRINPKTGGIVMLGRS
DGTLNPNGVRFGSSEIYNIVESFEEVEDSLCVPQYNKYREERVILFLKMASGHAFQPDLV
KRIRDAIRMGLSARHVPSLILETKGIPYTLNGKKVEVAVKQIIAGKAVEQGGAFSNPETL
DLYRDIPELQGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86V21	1.000	1.000	0.000	672	1.000	1.000	Q86V21.pdb.gz	AACS_HUMAN Acetoacetyl-CoA synthetase OS=Homo sapiens OX=9606 GN=AACS PE=1 SV=1
2	AFDB:Q9JMI1	0.986	0.986	0.000	672	0.885	0.885	Q9JMI1.pdb.gz	AACS_RAT Acetoacetyl-CoA synthetase OS=Rattus norvegicus OX=10116 GN=Aacs PE=1 SV=1
3	AFDB:D7PHZ3	0.924	0.860	2.143E-79	723	0.426	0.396	D7PHZ3.pdb.gz	VRTB_PENAE Malonamoyl-CoA synthetase vrtB OS=Penicillium aethiopicum OX=36650 GN=vrtB PE=1 SV=1
4	AFDB:P78773	0.864	0.877	7.416E-59	662	0.214	0.218	P78773.pdb.gz	ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC191.02c PE=1 SV=2
5	AFDB:P52910	0.861	0.848	6.398E-58	683	0.208	0.205	P52910.pdb.gz	ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACS2 PE=1 SV=1
6	AFDB:Q726Y7	0.726	0.738	5.519E-57	661	0.232	0.236	Q726Y7.pdb.gz	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
7	AFDB:Q973W5	0.695	0.708	7.328E-57	659	0.250	0.255	Q973W5.pdb.gz	HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=STK_07830 PE=1 SV=1
8	AFDB:Q01574	0.868	0.820	1.816E-56	713	0.220	0.208	Q01574.pdb.gz	ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACS1 PE=1 SV=2
9	AFDB:P16928	0.865	0.867	2.034E-56	670	0.204	0.204	P16928.pdb.gz	ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=facA PE=2 SV=2
10	AFDB:P27550	0.869	0.894	1.115E-55	652	0.232	0.239	P27550.pdb.gz	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
11	PDB:2p20A	0.854	0.894	1.197E-55	641	0.223	0.234	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
12	PDB:1ry2A	0.711	0.775	5.523E-50	615	0.207	0.226	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
13	PDB:3b7wA	0.683	0.847	2.430E-36	537	0.150	0.188	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
14	PDB:3rg2C	0.640	0.697	5.312E-34	613	0.149	0.163	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
15	PDB:1ultA	0.528	0.656	1.244E-33	533	0.140	0.176	1ultA.pdb.gz
16	PDB:6q2mA	0.551	0.669	8.744E-32	544	0.137	0.169	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
17	PDB:7kydA	0.548	0.679	1.727E-31	534	0.132	0.167	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
18	PDB:5ja2A	0.621	0.352	4.042E-31	1238	0.147	0.080	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
19	PDB:5bsmA	0.536	0.666	2.398E-29	530	0.141	0.179	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
20	PDB:3r44A	0.509	0.667	8.348E-29	502	0.119	0.159	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D7PHZ3	0.0	541	723	0.445	0.414	VRTB_PENAE Malonamoyl-CoA synthetase vrtB OS=Penicillium aethiopicum OX=36650 GN=vrtB PE=1 SV=1
2	Q86V21	0.0	1396	672	1.000	1.000	AACS_HUMAN Acetoacetyl-CoA synthetase OS=Homo sapiens OX=9606 GN=AACS PE=1 SV=1
3	Q9JMI1	0.0	1268	672	0.893	0.893	AACS_RAT Acetoacetyl-CoA synthetase OS=Rattus norvegicus OX=10116 GN=Aacs PE=1 SV=1
4	Q973W5	1.61e-58	211	659	0.272	0.278	HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=STK_07830 PE=1 SV=1
5	Q726Y7	4.37e-55	201	661	0.237	0.241	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
6	Q9NR19	7.45e-53	196	701	0.251	0.241	ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1
7	B1WC11	2.44e-52	194	701	0.251	0.241	B1WC11_RAT propionate--CoA ligase OS=Rattus norvegicus OX=10116 GN=Acss2 PE=2 SV=1
8	G3V9U0	3.95e-52	194	745	0.251	0.227	G3V9U0_RAT propionate--CoA ligase OS=Rattus norvegicus OX=10116 GN=Acss2 PE=1 SV=2
9	Q9QXG4	4.09e-52	193	701	0.250	0.240	ACSA_MOUSE Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus OX=10090 GN=Acss2 PE=1 SV=2
10	A0A8I6GJ11	9.89e-51	190	758	0.257	0.228	A0A8I6GJ11_RAT propionate--CoA ligase OS=Rattus norvegicus OX=10116 GN=Acss2 PE=1 SV=1
11	A0A8I6AD12	1.99e-50	189	702	0.247	0.236	A0A8I6AD12_RAT propionate--CoA ligase OS=Rattus norvegicus OX=10116 GN=Acss2 PE=1 SV=1
12	Q9VP61	2.16e-50	188	670	0.226	0.227	ACSA_DROME Acetyl-coenzyme A synthetase OS=Drosophila melanogaster OX=7227 GN=AcCoAS PE=2 SV=1
13	Q8ZKF6	2.18e-50	188	652	0.238	0.245	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
14	P27550	7.48e-50	186	652	0.238	0.245	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
15	Q5E268	2.71e-49	185	649	0.231	0.239	Q5E268_ALIF1 Acetyl-coenzyme A synthetase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=acs PE=3 SV=2
16	A4YGR1	4.92e-49	184	661	0.240	0.244	HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_1456 PE=1 SV=1
17	B9DGD6	1.40e-48	184	743	0.250	0.226	ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana OX=3702 GN=ACS PE=1 SV=1
18	Q57XD7	7.68e-48	181	673	0.223	0.223	Q57XD7_TRYB2 Acetyl-coenzyme A synthetase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.430 PE=3 SV=1
19	D3ZZN3	3.88e-47	179	682	0.235	0.232	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1
20	Q99NB1	2.46e-45	174	682	0.222	0.218	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16177 ACAS_N	5.2e-08	44.0	Acetyl-coenzyme A synthetase N-terminus
2	PF00501 AMP-binding	6.4e-41	152.0	AMP-binding enzyme
3	PF01878 EVE	4.7e+02	12.2	EVE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322706	0.954	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
2	9606.ENSP00000265838	0.950	Acetyl-CoA acetyltransferase, mitochondrial
3	9606.ENSP00000358414	0.948	Hydroxymethylglutaryl-CoA synthase, mitochondrial
4	9606.ENSP00000376184	0.944	D-beta-hydroxybutyrate dehydrogenase, mitochondrial
5	9606.ENSP00000356015	0.938	Acetyl-CoA acetyltransferase, cytosolic
6	9606.ENSP00000363614	0.937	Hydroxymethylglutaryl-CoA lyase, mitochondrial
7	9606.ENSP00000196371	0.924	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
8	9606.ENSP00000381654	0.915	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
9	9606.ENSP00000231887	0.914	Peroxisomal bifunctional enzyme
10	9606.ENSP00000296424	0.911	3-hydroxybutyrate dehydrogenase type 2
11	9606.ENSP00000361914	0.865	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
12	9606.ENSP00000301012	0.838	Diphosphomevalonate decarboxylase
13	9606.ENSP00000325548	0.800	Cytosolic non-specific dipeptidase
14	9606.ENSP00000322991	0.774	Branched-chain-amino-acid aminotransferase, mitochondrial
15	9606.ENSP00000380837	0.767	Lanosterol synthase
16	9606.ENSP00000443459	0.760	Branched-chain-amino-acid aminotransferase, cytosolic
17	9606.ENSP00000337040	0.740	Protein unc-119 homolog A
18	9606.ENSP00000360939	0.737	UMP-CMP kinase
19	9606.ENSP00000304592	0.730	Fatty acid synthase
20	9606.ENSP00000349078	0.693	Farnesyl pyrophosphate synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016878	1.000	acid-thiol ligase activity
GO:0016405	1.000	CoA-ligase activity
GO:0005488	0.976	binding
GO:0005515	0.973	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0009058	0.978	biosynthetic process
GO:0006629	0.977	lipid metabolic process
GO:0044281	0.960	small molecule metabolic process
GO:1901576	0.918	organic substance biosynthetic process
GO:1901568	0.846	fatty acid derivative metabolic process
GO:0008610	0.836	lipid biosynthetic process
GO:0044283	0.828	small molecule biosynthetic process
GO:0044249	0.647	cellular biosynthetic process
GO:0006091	0.340	generation of precursor metabolites and energy
GO:1901570	0.329	fatty acid derivative biosynthetic process
GO:0065007	0.311	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043229	0.847	intracellular organelle
GO:0043231	0.773	intracellular membrane-bounded organelle
GO:0016020	0.718	membrane
GO:0043233	0.687	organelle lumen
GO:0070013	0.673	intracellular organelle lumen
GO:0012505	0.421	endomembrane system
GO:0005634	0.367	nucleus
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.

[back to server]