StarFunc result for job id Q86V48

User Input

>input (1076 residues)
MAEFTSYKETASSRHLRFKLQSLSRRLDELEEATKNLQKAEDELLDLQDKVIQAEGSNSS
MLAEIEVLRQRVLRIEGKDEEIKRAEDLCRLMKEKLEEEENLTRELKSEIERLQKRMAEL
EKLEEAFSRSKNDCTQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLA
SELEKLKSLTLSFVSERKYLNEKEKENEKLIKELTQKLEQNKKMNRDYTRNASNLERNDL
RIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSENEKNRNQEDNKVKDLNQEIEKLKT
QIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQLEEIKLQIKKQKELENGEVEG
EDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKRERLRNREFALNNENYSLSNRQ
VSSPSFTNRRAAKASHMGVSTDSGTQETKKTEDRFVPGSSQSEGKKSREQPSVLSRYPPA
AQEHSKAWKGTSKPGTESGLKGKVEKTTRTFSDTTHGSVPSDPLGRADKASDTSSETVFG
KRGHVLGNGSQVTQAANSGCSKAIGALASSRRSSSEGLSKGKKAANGLEADNSCPNSKAP
VLSKYPYSCRSQENILQGFSTSHKEGVNQPAAVVMEDSSPHEALRCRVIKSSGREKPDSD
DDLDIASLVTAKLVNTTITPEPEPKPQPNSREKAKTRGAPRTSLFENDKDAGMENESVKS
VRASTNTMELPDTNGAGVKSQRPFSPREALRSRAIIKPVIVDKDVKKIMGGSGTETTLEK
QKPVSKPGPNKVTSSITIYPSDSSSPRAAPGEALRERHTSTSNIQVGLAELTSVSNHVSS
PFELSIHKHDITLQLAEAERMADGPLKDRPETVVSRSSIIIKPSDPVERNSHAPPAETIR
WKSHSAPSEVGFSDARHVTVRNAWKSRRDLKSLEDPPTRIGKNVESTNSNAYTQRSSTDF
SELEQPRSCLFEQGTRRVGPSSGDAPEPSSRRTQSSLTVSEVLTRRNRVGDTITVAAWNH
SASMEEEGEDCTLSVYRQLHNSLDPSELPGKQGLPESGRVRAEERLRPTRPCAEEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86V48	0.999	0.999	0.000	1076	1.000	1.000	Q86V48.pdb.gz	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
2	AFDB:Q8R4U7	0.331	0.333	0.000	1068	0.804	0.810	Q8R4U7.pdb.gz	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
3	AFDB:Q6VGS5	0.123	0.072	2.236E-4	2009	0.178	0.095	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
4	AFDB:P12036	0.111	0.116	5.431E-4	1026	0.151	0.159	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
5	AFDB:Q6P5H2	0.071	0.045	9.814E-4	1864	0.178	0.103	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
6	AFDB:P21263	0.062	0.039	5.377E-3	1893	0.156	0.089	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
7	AFDB:Q9Y7J9	0.082	0.090	5.377E-3	968	0.122	0.135	Q9Y7J9.pdb.gz	MCP5_SCHPO Meiotic coiled-coil protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcp5 PE=1 SV=1
8	AFDB:Q32MZ4	0.058	0.076	5.790E-3	808	0.130	0.173	Q32MZ4.pdb.gz	LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2
9	AFDB:P19246	0.111	0.110	8.381E-3	1090	0.163	0.161	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
10	AFDB:Q9P219	0.100	0.062	1.213E-2	2028	0.168	0.089	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
11	PDB:4v60A	0.073	0.092	7.681	812	0.037	0.049	4v60A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86V48	0.0	2187	1076	1.000	1.000	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
2	Q8R4U7	0.0	1690	1068	0.804	0.810	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
3	A0A075B6G6	1.52e-77	279	1114	0.198	0.191	A0A075B6G6_HUMAN Filamin A interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
4	Q7Z7B0	2.59e-77	279	1213	0.198	0.176	FLIP1_HUMAN Filamin-A-interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
5	Q8K4T4	5.95e-76	275	1212	0.197	0.175	FLIP1_RAT Filamin-A-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Filip1 PE=1 SV=1
6	Q9CS72	7.33e-76	275	1214	0.199	0.176	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
7	Q4L180	3.23e-58	221	1135	0.145	0.137	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
8	P23731	0.013	42.0	589	0.057	0.104	IFEB_ASCSU Intermediate filament protein B OS=Ascaris suum OX=6253 PE=1 SV=1
9	E9PV66	0.036	40.8	2605	0.036	0.015	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
10	C0H4K6	0.048	40.4	3893	0.071	0.020	C0H4K6_PLAF7 E3 ubiquitin-protein ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0704600 PE=4 SV=1
11	Q6VGS5	0.060	40.0	2009	0.094	0.050	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
12	P91349	0.079	39.7	1198	0.085	0.076	SPD5_CAEEL Spindle-defective protein 5 OS=Caenorhabditis elegans OX=6239 GN=spd-5 PE=1 SV=2
13	G3I183	0.20	38.1	957	0.068	0.076	G3I183_CRIGR Oral-facial-digital syndrome 1 protein-like OS=Cricetulus griseus OX=10029 GN=I79_017133 PE=1 SV=1
14	A0A8I3Q5R3	0.31	37.7	1181	0.065	0.059	A0A8I3Q5R3_CANLF LisH domain-containing protein OS=Canis lupus familiaris OX=9615 GN=OFD1 PE=1 SV=1
15	Q6AW69	0.50	37.0	1297	0.083	0.069	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
16	Q910C5	0.55	37.0	1931	0.080	0.045	Q910C5_CHICK Chick atrial myosin heavy chain OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q9SAF6	0.61	36.6	1128	0.074	0.071	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
18	Q9R269	0.89	36.2	1755	0.035	0.022	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
19	D3ZUD5	1.3	35.4	1027	0.069	0.072	D3ZUD5_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=1 SV=2
20	F4I8Q1	1.4	35.4	790	0.027	0.037	F4I8Q1_ARATH Myosin heavy chain, embryonic smooth protein OS=Arabidopsis thaliana OX=3702 GN=PICL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18474 DUF5614	2.5e+02	12.4	Family of unknown function (DUF5614)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303758

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
2	9606.ENSP00000338629	0.706	Arginine-glutamic acid dipeptide repeats protein
3	9606.ENSP00000343001	0.659	Ubiquitin conjugation factor E4 B
4	9606.ENSP00000258111	0.622	Calcium-activated potassium channel subunit beta-4
5	9606.ENSP00000246151	0.599	Promotes megakaryocyte differentiation by up-regulating RUNX1 expression . Regulates RUNX1 expression by activating the proximal promoter of the RUNX1 gene and by enhancing the translation activity of an internal ribosome entry site (IRES) element in the RUNX1 gene
6	9606.ENSP00000348308	0.598	Matrix metalloproteinase-23
7	9606.ENSP00000271277	0.595	CTTNBP2 N-terminal-like protein
8	9606.ENSP00000271620	0.587	Exopolyphosphatase PRUNE1
9	9606.ENSP00000367498	0.580	Leucine-rich repeat-containing protein 47
10	9606.ENSP00000258400	0.574	5-hydroxytryptamine receptor 2B
11	9606.ENSP00000483313	0.571	Wiskott-Aldrich syndrome protein family member 2
12	9606.ENSP00000364912	0.567	Msx2-interacting protein
13	9606.ENSP00000384223	0.552	Endothelin-converting enzyme 2
14	9606.ENSP00000364028	0.551	Endothelin-converting enzyme 1
15	9606.ENSP00000391942	0.532	Adaptin ear-binding coat-associated protein 2
16	9606.ENSP00000160373	0.528	Cortactin-binding protein 2
17	9606.ENSP00000252992	0.509	Centrosomal protein of 85 kDa
18	9606.ENSP00000365908	0.507	Protein prune homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.923	multicellular organismal process
GO:0048856	0.841	anatomical structure development
GO:0065007	0.806	biological regulation
GO:0050789	0.802	regulation of biological process
GO:0009987	0.787	cellular process
GO:0007275	0.726	multicellular organism development
GO:0050794	0.721	regulation of cellular process
GO:0009653	0.686	anatomical structure morphogenesis
GO:0048731	0.679	system development
GO:0072359	0.648	circulatory system development
GO:0048729	0.633	tissue morphogenesis
GO:0009790	0.613	embryo development
GO:0060429	0.611	epithelium development
GO:0048513	0.587	animal organ development
GO:0035295	0.582	tube development
GO:0009792	0.562	embryo development ending in birth or egg hatching
GO:0003205	0.476	cardiac chamber development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.995	nucleus
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0016020	0.977	membrane
GO:0005576	0.975	extracellular region
GO:0031982	0.953	vesicle
GO:0005856	0.934	cytoskeleton
GO:0005615	0.916	extracellular space
GO:0070062	0.906	extracellular exosome
GO:0005737	0.904	cytoplasm
GO:0005815	0.724	microtubule organizing center
GO:0005813	0.546	centrosome
GO:0012505	0.310	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]