StarFunc result for job id Q86VB7

User Input

>input (1156 residues)
MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKC
SGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSC
RGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRW
GTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKH
QGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDA
AVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAIWQCKHHEWGKHYCNHNED
AGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRL
VGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQI
WAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKT
LGAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGARFGKGNGQIWRHMFHCTGTEQHMG
DCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGPTRPTIPEESAVACIESGQLR
LVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATGSAHFGEGTGP
IWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE
VFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPD
TLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDL
DDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGH
KEDAAVNCTDISVQKTPQKATTGRSSRQSSFIAVGILGVVLLAIFVALFFLTKKRRQRQR
LAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGM
EKEAILSHTEKENGNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JVY2	0.444	0.460	0.000	1111	0.715	0.743	A0A0G2JVY2.pdb.gz	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
2	AFDB:Q86VB7	1.000	1.000	0.000	1156	1.000	1.000	Q86VB7.pdb.gz	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
3	AFDB:Q9UGM3	0.137	0.096	1.825E-103	2413	0.420	0.201	Q9UGM3.pdb.gz	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
4	AFDB:Q60997	0.116	0.087	9.920E-90	2085	0.394	0.219	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
5	AFDB:B3F5L4	0.181	0.187	5.268E-88	1112	0.342	0.355	B3F5L4.pdb.gz	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
6	AFDB:A0A1B0GSB0	0.181	0.210	3.953E-85	991	0.332	0.387	A0A1B0GSB0.pdb.gz	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
7	AFDB:B3F5L5	0.291	0.335	8.213E-82	996	0.311	0.360	B3F5L5.pdb.gz	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
8	AFDB:Q4G0T1	0.151	0.167	1.670E-76	1027	0.311	0.350	Q4G0T1.pdb.gz	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
9	AFDB:Q8BV57	0.141	0.121	1.504E-57	1371	0.265	0.223	Q8BV57.pdb.gz	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
10	AFDB:A1L4H1	0.121	0.096	3.360E-56	1573	0.256	0.188	A1L4H1.pdb.gz	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
11	PDB:2xrcC	0.089	0.212	3.180E-5	454	0.029	0.075	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
12	PDB:2xrcB	0.087	0.197	2.202E-4	485	0.025	0.060	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
13	PDB:7u05B	0.054	0.062	7.615E-1	815	0.037	0.053	7u05B.pdb.gz
14	PDB:6s1kA	0.053	0.107	8.431E-1	383	0.023	0.070	6s1kA.pdb.gz
15	PDB:6b0tA	0.041	0.074	1.403	487	0.018	0.043	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
16	PDB:2pmzE	0.042	0.131	2.335	176	0.016	0.102	2pmzE.pdb.gz	The X-ray crystal structure of RNA polymerase from Archaea
17	PDB:7jn7A	0.040	0.051	3.169	846	0.011	0.015	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
18	PDB:8bfsA	0.043	0.094	3.169	274	0.015	0.062	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
19	PDB:6n8sA	0.035	0.044	3.885	834	0.027	0.037	6n8sA.pdb.gz
20	PDB:7odrS	0.023	0.094	3.885	161	0.012	0.087	7odrS.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVY2	0.0	1706	1151	0.729	0.732	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
2	A0A1B0GSB0	0.0	594	991	0.324	0.378	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
3	A0A8I5ZQF0	0.0	1659	1109	0.707	0.737	A0A8I5ZQF0_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=1
4	B3F5L4	0.0	612	1112	0.337	0.351	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
5	B3F5L5	0.0	590	996	0.316	0.366	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
6	D3Z9U2	0.0	1670	1110	0.715	0.744	D3Z9U2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=4 SV=2
7	Q60997	0.0	593	2085	0.318	0.176	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
8	Q86VB7	0.0	2352	1156	1.000	1.000	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
9	Q8BIC8	0.0	586	991	0.323	0.376	Q8BIC8_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart1 PE=2 SV=1
10	Q8CGY7	0.0	597	989	0.324	0.378	Q8CGY7_MOUSE Scavenger receptor cysteine-rich type 1 protein CD163c-alpha OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
11	Q9UGM3	0.0	716	2413	0.363	0.174	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
12	Q4G0T1	1.11e-156	496	1027	0.292	0.329	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
13	Q8BV57	3.01e-88	314	1371	0.196	0.166	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
14	Q8C9T4	1.32e-87	292	446	0.151	0.392	Q8C9T4_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart2 PE=2 SV=1
15	A1L4H1	2.62e-87	313	1573	0.201	0.147	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
16	P56730	1.55e-86	301	875	0.163	0.216	NETR_HUMAN Neurotrypsin OS=Homo sapiens OX=9606 GN=PRSS12 PE=2 SV=2
17	O43866	2.10e-69	238	347	0.117	0.389	CD5L_HUMAN CD5 antigen-like OS=Homo sapiens OX=9606 GN=CD5L PE=1 SV=1
18	Q8CIZ5	8.40e-68	253	1418	0.139	0.114	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
19	O08762	2.27e-67	244	761	0.119	0.180	NETR_MOUSE Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1
20	Q9QWK4	3.41e-66	229	352	0.116	0.381	CD5L_MOUSE CD5 antigen-like OS=Mus musculus OX=10090 GN=Cd5l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00530 SRCR	3e-247	812.2	Scavenger receptor cysteine-rich domain
2	PF15494 SRCR_2	2.6e-19	81.0	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348170	0.998	Haptoglobin
2	9606.ENSP00000399421	0.991	Platelet glycoprotein 4
3	9606.ENSP00000370767	0.987	Pancreatic secretory granule membrane major glycoprotein GP2
4	9606.ENSP00000412237	0.981	Interleukin-10
5	9606.ENSP00000293825	0.976	Tumor necrosis factor ligand superfamily member 12
6	9606.ENSP00000385675	0.969	Interleukin-6
7	9606.ENSP00000309968	0.929	Disintegrin and metalloproteinase domain-containing protein 17
8	9606.ENSP00000216181	0.925	Myosin-9
9	9606.ENSP00000286301	0.917	Macrophage colony-stimulating factor 1 receptor
10	9606.ENSP00000455897	0.913	Macrophage mannose receptor 1
11	9606.ENSP00000250092	0.899	Macrosialin
12	9606.ENSP00000341141	0.894	Sialoadhesin
13	9606.ENSP00000363869	0.891	V-set and immunoglobulin domain-containing protein 4
14	9606.ENSP00000304236	0.874	Monocyte differentiation antigen CD14
15	9606.ENSP00000313967	0.871	Complement C1q subcomponent subunit B
16	9606.ENSP00000356946	0.861	Low affinity immunoglobulin gamma Fc region receptor III-A
17	9606.ENSP00000363773	0.859	Complement C1q subcomponent subunit A
18	9606.ENSP00000262629	0.835	TYRO protein tyrosine kinase-binding protein
19	9606.ENSP00000392770	0.831	Membrane-spanning 4-domains subfamily A member 6A
20	9606.ENSP00000358165	0.795	High affinity immunoglobulin gamma Fc receptor I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005044	1.000	scavenger receptor activity
GO:0097110	1.000	scaffold protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010259	0.978	multicellular organism aging
GO:0050896	0.674	response to stimulus
GO:0009987	0.653	cellular process
GO:0065007	0.649	biological regulation
GO:0050789	0.565	regulation of biological process
GO:0050794	0.522	regulation of cellular process
GO:0048518	0.484	positive regulation of biological process
GO:0048522	0.392	positive regulation of cellular process
GO:0002376	0.334	immune system process
GO:0006950	0.303	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.998	cell surface
GO:0005886	0.980	plasma membrane
GO:0005576	0.863	extracellular region
GO:0005622	0.859	intracellular anatomical structure
GO:0043227	0.850	membrane-bounded organelle
GO:0005737	0.811	cytoplasm
GO:0043231	0.805	intracellular membrane-bounded organelle
GO:0031982	0.590	vesicle
GO:0030659	0.419	cytoplasmic vesicle membrane
GO:0005829	0.374	cytosol
GO:0098588	0.362	bounding membrane of organelle
GO:0030666	0.353	endocytic vesicle membrane
GO:0009897	0.336	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]