StarFunc result for job id Q86VD1

User Input

>input (984 residues)
MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGG
FMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYGNGLKSGSMRIGKDFILFTKK
EETMTCVFFSQTFCEEESLSEVVVPMPSWLIRTRESVTDDPQKFAMELSIIYKYSPFKTE
AELMQQFDVIYGKCGTLLVIYNLKLLLNGEPELDVKTDKEDILMAGALEDFPARWSFRAY
TSVLYFNPWMRIFIQAKRVKTKHLCYCLYRPRKYLYVTSSFKGAFKDEVKKAEEAVKIAE
SILKEAQIKVNQCDRTSLSSAKDVLQRALEDVEAKQKNLKEKQRELKTARTLSLFYGVNV
ENRSQAGMFIYSNNRLIKMHEKVGSQLKLKSLLGAGVVGIVNIPLEVMEPSHNKQEFLNV
QEYNHLLKVMGQYLVQYCKDTGINNRNLTLFCNEFGYQNDIDVEKPLNSFQYQRRQAMGI
PFIIQCDLCLKWRVLPSSTNYQEKEFFDIWICANNPNRLENSCHQVECLPSIPLGTMSTI
SPSKNEKEKQLRESVIKYQNRLAEQQPQPQFIPVDEITVTSTCLTSAHKENTKTQKIRLL
GDDLKHESLSSFELSASRRGQKRNIEETDSDVEYISETKIMKKSMEEKMNSQQQRIPVAL
PENVKLAERSQRSQIANITTVWRAQPTEGCLKNAQAASWEMKRKQSLNFVEECKVLTEDE
NTSDSDIILVSDKSNTDVSLKQEKKEIPLLNQEKQELCNDVLAMKRSSSLPSWKSLLNVP
MEDVNLSSGHIARVSVSGSCKVASSPASSQSTPVKETVRKLKSKLREILLYFFPEHQLPS
ELEEPALSCELEQCPEQMNKKLKMCFNQIQNTYMVQYEKKIKRKLQSIIYDSNTRGIHNE
ISLGQCENKRKISEDKLKNLRIKLALLLQKLQLGGPEGDLEQTDTYLEALLKEDNLLFQN
NLNKVTIDARHRLPLEKNEKTSEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VD1	1.000	1.000	0.000	984	1.000	1.000	Q86VD1.pdb.gz	MORC1_HUMAN MORC family CW-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=MORC1 PE=2 SV=2
2	AFDB:Q9WVL5	0.623	0.643	0.000	950	0.650	0.674	Q9WVL5.pdb.gz	MORC1_MOUSE MORC family CW-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Morc1 PE=2 SV=1
3	AFDB:Q9Y6X9	0.562	0.537	1.606E-77	1032	0.371	0.354	Q9Y6X9.pdb.gz	MORC2_HUMAN ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=2
4	AFDB:Q8C5W4	0.552	0.533	1.227E-76	1022	0.353	0.340	Q8C5W4.pdb.gz	MOR2B_MOUSE ATPase MORC2B OS=Mus musculus OX=10090 GN=Morc2b PE=1 SV=2
5	PDB:7kclB	0.245	0.373	2.251E-9	614	0.062	0.099	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
6	PDB:5tthB	0.233	0.348	3.146E-8	621	0.059	0.093	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
7	PDB:5fwkA	0.206	0.305	3.530E-7	638	0.055	0.085	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
8	PDB:2cg9B	0.223	0.338	5.478E-7	618	0.055	0.087	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
9	PDB:7p8vA	0.193	0.497	1.939E-6	331	0.057	0.169	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
10	PDB:2zbkB	0.204	0.354	6.493E-6	506	0.065	0.126	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
11	PDB:7kw7B	0.198	0.290	1.652E-5	628	0.056	0.088	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
12	PDB:2q2eB	0.226	0.348	1.194E-4	581	0.069	0.117	2q2eB.pdb.gz
13	AFDB:Q386B1	0.067	0.043	1.602E-2	1673	0.105	0.062	Q386B1.pdb.gz	Q386B1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1540 PE=4 SV=1
14	AFDB:O74360	0.062	0.065	1.442E-1	933	0.079	0.084	O74360.pdb.gz	RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga4 PE=1 SV=2
15	AFDB:Q8H1F0	0.086	0.140	1.701E-1	547	0.076	0.137	Q8H1F0.pdb.gz	BZP29_ARATH bZIP transcription factor 29 OS=Arabidopsis thaliana OX=3702 GN=BZIP29 PE=2 SV=1
16	PDB:5ng5A	0.059	0.143	1.882E-1	340	0.016	0.047	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
17	AFDB:Q8CFC9	0.042	0.064	1.899E-1	601	0.084	0.138	Q8CFC9.pdb.gz	LZTS1_RAT Leucine zipper putative tumor suppressor 1 OS=Rattus norvegicus OX=10116 GN=Lzts1 PE=1 SV=3
18	PDB:6dhdA	0.040	0.068	2.219E-1	501	0.009	0.018	6dhdA.pdb.gz	Structures of bovine glutamate dehydrogenase complexes elucidate the mechanism of purine regulation.
19	AFDB:Q383W7	0.072	0.087	2.239E-1	764	0.061	0.079	Q383W7.pdb.gz	Q383W7_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1380 PE=4 SV=1
20	AFDB:Q61595	0.076	0.058	2.239E-1	1327	0.058	0.043	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q69ZX6	0.0	568	1030	0.287	0.274	MOR2A_MOUSE ATPase MORC2A OS=Mus musculus OX=10090 GN=Morc2a PE=1 SV=2
2	Q86VD1	0.0	2038	984	1.000	1.000	MORC1_HUMAN MORC family CW-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=MORC1 PE=2 SV=2
3	Q9WVL5	0.0	1242	950	0.650	0.674	MORC1_MOUSE MORC family CW-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Morc1 PE=2 SV=1
4	Q9Y6X9	0.0	576	1032	0.295	0.281	MORC2_HUMAN ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=2
5	Q8C5W4	3.34e-180	552	1022	0.279	0.269	MOR2B_MOUSE ATPase MORC2B OS=Mus musculus OX=10090 GN=Morc2b PE=1 SV=2
6	F7BJB9	7.52e-55	208	942	0.152	0.159	MORC3_MOUSE MORC family CW-type zinc finger protein 3 OS=Mus musculus OX=10090 GN=Morc3 PE=1 SV=1
7	Q14149	3.02e-54	207	939	0.150	0.158	MORC3_HUMAN MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3
8	Q23243	4.44e-51	196	845	0.149	0.174	MORC1_CAEEL ATPase morc-1 OS=Caenorhabditis elegans OX=6239 GN=morc-1 PE=1 SV=2
9	Q8TE76	3.99e-42	169	937	0.101	0.106	MORC4_HUMAN MORC family CW-type zinc finger protein 4 OS=Homo sapiens OX=9606 GN=MORC4 PE=1 SV=2
10	Q56Y74	3.91e-39	157	663	0.130	0.193	MORC6_ARATH Protein MICRORCHIDIA 6 OS=Arabidopsis thaliana OX=3702 GN=MORC6 PE=1 SV=1
11	Q5FV35	1.19e-34	143	626	0.137	0.216	MORC2_ARATH Protein MICRORCHIDIA 2 OS=Arabidopsis thaliana OX=3702 GN=MORC2 PE=1 SV=1
12	F4KAF2	7.03e-34	142	800	0.102	0.125	MORC4_ARATH Protein MICRORCHIDIA 4 OS=Arabidopsis thaliana OX=3702 GN=MORC4 PE=1 SV=2
13	Q84WV6	5.24e-33	138	635	0.104	0.161	MORC1_ARATH Protein MICRORCHIDIA 1 OS=Arabidopsis thaliana OX=3702 GN=MORC1 PE=1 SV=1
14	F4JRS4	9.54e-32	135	707	0.102	0.141	MORC7_ARATH Protein MICRORCHIDIA 7 OS=Arabidopsis thaliana OX=3702 GN=MORC7 PE=1 SV=1
15	Q9LZM1	0.70	36.2	453	0.029	0.064	ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana OX=3702 GN=ORP3A PE=1 SV=1
16	Q2LAE1	2.1	34.7	1759	0.015	0.009	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
17	H7C1V1	2.4	33.5	191	0.039	0.199	H7C1V1_HUMAN MORC family CW-type zinc finger 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=1
18	Q8LA53	2.7	33.9	272	0.011	0.040	MBD2_ARATH Methyl-CpG-binding domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=MBD2 PE=1 SV=1
19	A0A2R8PVX9	3.4	34.3	4580	0.030	0.007	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
20	A5WV02	3.5	34.3	4577	0.030	0.007	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02518 HATPase_c	1e+02	14.8	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
2	PF13589 HATPase_c_3	1.4e-19	81.8	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF17942 Morc6_S5	3.7e-14	64.4	Morc6 ribosomal protein S5 domain 2-like
4	PF05348 UMP1	3.7e+02	12.7	Proteasome maturation factor UMP1
5	PF07496 zf-CW	5.4e-08	44.0	CW-type Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000232603

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384115	0.765	Meiosis inhibitor protein 1
2	9606.ENSP00000320184	0.714	Mitochondrial ribosomal protein S23
3	9606.ENSP00000355028	0.694	E3 ubiquitin-protein ligase DZIP3
4	9606.ENSP00000363634	0.694	Thioredoxin domain-containing protein 8
5	9606.ENSP00000360310	0.686	Meiotic recombination protein SPO11
6	9606.ENSP00000350402	0.684	HERV-H LTR-associating protein 2
7	9606.ENSP00000261047	0.683	Guanylyl cyclase-activating protein 3
8	9606.ENSP00000295746	0.674	Protein CIP2A
9	9606.ENSP00000414109	0.672	Holliday junction recognition protein
10	9606.ENSP00000415579	0.665	Transcriptional repressor CTCFL
11	9606.ENSP00000245255	0.631	Piwi-like protein 1
12	9606.ENSP00000472308	0.626	Testis-expressed protein 101
13	9606.ENSP00000192788	0.603	UHRF1-binding protein 1
14	9606.ENSP00000264538	0.600	Intraflagellar transport protein 57 homolog
15	9606.ENSP00000484824	0.583	Mucin-1
16	9606.ENSP00000316786	0.577	Corticosteroid 11-beta-dehydrogenase isozyme 2
17	9606.ENSP00000457788	0.567	Alpha-mannosidase 2C1
18	9606.ENSP00000483154	0.561	Protein FAM71D
19	9606.ENSP00000253031	0.560	Protein YIPF2
20	9606.ENSP00000262794	0.558	RNA helicase Mov10l1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.928	organic cyclic compound binding
GO:1901363	0.926	heterocyclic compound binding
GO:0003824	0.792	catalytic activity
GO:0016887	0.704	ATP hydrolysis activity
GO:0042393	0.318	histone binding
GO:0003676	0.310	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.946	multicellular organismal process
GO:0032502	0.932	developmental process
GO:0022414	0.912	reproductive process
GO:0007276	0.884	gamete generation
GO:0009987	0.869	cellular process
GO:0007283	0.829	spermatogenesis
GO:0065007	0.647	biological regulation
GO:0050789	0.598	regulation of biological process
GO:0050794	0.590	regulation of cellular process
GO:0019222	0.306	regulation of metabolic process
GO:0008152	0.300	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.778	membrane-enclosed lumen
GO:0070013	0.772	intracellular organelle lumen
GO:0005737	0.721	cytoplasm
GO:0031981	0.719	nuclear lumen
GO:0005654	0.578	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.704	ATP + H2O = ADP + H(+) + phosphate

[back to server]