StarFunc result for job id Q86VD7

User Input

>input (318 residues)
MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII
FQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGS
YYGFRGEALPPWPRLFAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE
EGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPYPFERMIFGACAGLIG
QSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVG
ISFTTFDLMQILLRHLQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7K2	0.984	0.984	3.565E-39	318	1.000	1.000	A0A024R7K2.pdb.gz
2	AFDB:Q0P483	0.904	0.895	2.675E-33	321	0.733	0.726	Q0P483.pdb.gz	S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1
3	AFDB:Q9VDL7	0.894	0.780	4.027E-25	365	0.525	0.458	Q9VDL7.pdb.gz	Q9VDL7_DROME Dephosphocoenzyme A carrier, isoform A OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=2 SV=2
4	AFDB:Q9M058	0.831	0.798	1.978E-19	332	0.362	0.346	Q9M058.pdb.gz	Q9M058_ARATH Ca-dependent solute carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=F1I16_50 PE=1 SV=1
5	AFDB:A2CEQ0	0.827	0.569	5.181E-18	469	0.333	0.226	A2CEQ0.pdb.gz	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
6	AFDB:Q38BB0	0.820	0.380	5.884E-18	704	0.396	0.179	Q38BB0.pdb.gz	Q38BB0_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2290 PE=3 SV=1
7	AFDB:Q9BV35	0.837	0.575	6.971E-18	468	0.324	0.220	Q9BV35.pdb.gz	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
8	AFDB:A2ASZ8	0.817	0.564	8.260E-18	469	0.346	0.235	A2ASZ8.pdb.gz	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
9	AFDB:P16260	0.813	0.780	1.065E-17	332	0.381	0.364	P16260.pdb.gz	GDC_HUMAN Solute carrier family 25 member 16 OS=Homo sapiens OX=9606 GN=SLC25A16 PE=1 SV=3
10	AFDB:F4JHS4	0.755	0.663	1.849E-17	366	0.362	0.314	F4JHS4.pdb.gz	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
11	PDB:4c9qB	0.726	0.790	5.005E-12	290	0.261	0.286	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.684	0.739	8.579E-11	293	0.261	0.283	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.471	0.503	5.183E-8	292	0.270	0.295	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:7p5jA	0.142	0.121	1.511E-1	399	0.170	0.135	7p5jA.pdb.gz
15	PDB:2nuuD	0.195	0.167	4.363E-1	410	0.164	0.127	2nuuD.pdb.gz	The crystal structure of the Escherichia coli AmtB-GlnK complex reveals how GlnK regulates the ammonia channel
16	PDB:4f4cA	0.126	0.055	4.363E-1	1250	0.097	0.025	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
17	PDB:4bwzA	0.124	0.110	4.749E-1	384	0.154	0.128	4bwzA.pdb.gz	A two-domain elevator mechanism for sodium/proton antiport.
18	PDB:6hrzB	0.166	0.234	4.749E-1	202	0.094	0.149	6hrzB.pdb.gz	A fragment-based approach towards the discovery of N-substituted tropinones as inhibitors of Mycobacterium tuberculosis transcriptional regulator EthR2.
19	PDB:7dxgA	0.135	0.080	7.572E-1	698	0.148	0.067	7dxgA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
20	PDB:7p5cA	0.113	0.097	7.572E-1	392	0.123	0.099	7p5cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VD7	0.0	646	318	1.000	1.000	S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens OX=9606 GN=SLC25A42 PE=1 SV=2
2	Q8R0Y8	0.0	573	318	0.921	0.921	S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus OX=10090 GN=Slc25a42 PE=1 SV=1
3	Q0P483	1.69e-170	477	321	0.739	0.732	S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1
4	Q9VDL7	9.12e-97	292	365	0.528	0.460	Q9VDL7_DROME Dephosphocoenzyme A carrier, isoform A OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=2 SV=2
5	A0A0B4LIE8	2.38e-95	288	364	0.535	0.467	A0A0B4LIE8_DROME Dephosphocoenzyme A carrier, isoform D OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=3 SV=1
6	Q8IN53	9.51e-95	284	290	0.516	0.566	Q8IN53_DROME Dephosphocoenzyme A carrier, isoform B OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=3 SV=3
7	Q8C0K5	4.32e-63	204	332	0.387	0.370	GDC_MOUSE Solute carrier family 25 member 16 OS=Mus musculus OX=10090 GN=Slc25a16 PE=1 SV=1
8	P16260	3.71e-62	202	332	0.377	0.361	GDC_HUMAN Solute carrier family 25 member 16 OS=Homo sapiens OX=9606 GN=SLC25A16 PE=1 SV=3
9	Q38BB0	1.66e-61	209	704	0.384	0.173	Q38BB0_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2290 PE=3 SV=1
10	F4JU70	1.35e-57	190	331	0.365	0.350	COAC2_ARATH Mitochondrial carrier protein CoAc2 OS=Arabidopsis thaliana OX=3702 GN=COAC2 PE=2 SV=1
11	B4F8I5	5.98e-57	189	335	0.368	0.349	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
12	Q6I583	1.80e-55	186	355	0.384	0.344	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
13	Q9M058	2.73e-55	184	332	0.393	0.377	Q9M058_ARATH Ca-dependent solute carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=F1I16_50 PE=1 SV=1
14	Q6NUK1	7.40e-54	184	477	0.324	0.216	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
15	Q8BMD8	8.49e-54	184	475	0.340	0.227	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1
16	A2CEQ0	5.05e-53	182	469	0.346	0.235	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
17	A2ASZ8	1.15e-52	181	469	0.336	0.228	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
18	F4JHS4	1.24e-51	176	366	0.384	0.333	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
19	Q9BV35	2.33e-51	178	468	0.330	0.224	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
20	Q6GQS1	5.22e-50	174	467	0.330	0.225	SCMC3_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00425 Chorismate_bind	3.1e+02	12.3	chorismate binding enzyme
2	PF00153 Mito_carr	3.5e-69	240.1	Mitochondrial carrier protein
3	PF18405 SLC25_like	86	13.6	Mitochondrial SLC25 homolog

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313885	0.790	Transmembrane protein 94
2	9606.ENSP00000162044	0.766	Transmembrane protein 161A
3	9606.ENSP00000325355	0.740	Caskin-2
4	9606.ENSP00000269919	0.732	Pyroglutamyl-peptidase 1
5	9606.ENSP00000369849	0.730	Mesenteric estrogen-dependent adipogenesis protein
6	9606.ENSP00000340983	0.710	Leucine-rich repeat-containing protein 25
7	9606.ENSP00000470652	0.707	Solute carrier family 35 member E1
8	9606.ENSP00000408576	0.675	Probable leucine--tRNA ligase, mitochondrial
9	9606.ENSP00000439856	0.672	Calcium homeostasis endoplasmic reticulum protein
10	9606.ENSP00000402756	0.629	Nuclear receptor 2C2-associated protein
11	9606.ENSP00000269878	0.606	Calcium and integrin binding family member 3
12	9606.ENSP00000247001	0.597	SURP and G-patch domain-containing protein 1
13	9606.ENSP00000247003	0.596	Probable ATP-dependent RNA helicase DDX49
14	9606.ENSP00000305071	0.590	DNA-binding protein RFXANK
15	9606.ENSP00000418529	0.577	NSFL1 cofactor p47
16	9606.ENSP00000300291	0.559	Cleavage and polyadenylation specificity factor subunit 5
17	9606.ENSP00000269740	0.533	Zinc transporter ZIP3
18	9606.ENSP00000322775	0.531	Inactive rhomboid protein 2
19	9606.ENSP00000353701	0.527	Dipeptidyl peptidase 3
20	9606.ENSP00000262764	0.523	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	1.000	organic anion transmembrane transporter activity
GO:1901702	0.999	salt transmembrane transporter activity
GO:0000295	0.999	adenine nucleotide transmembrane transporter activity
GO:0016787	0.995	hydrolase activity
GO:0016817	0.990	hydrolase activity, acting on acid anhydrides
GO:0005346	0.989	purine ribonucleotide transmembrane transporter activity
GO:0015101	0.832	organic cation transmembrane transporter activity
GO:0016462	0.829	pyrophosphatase activity
GO:0017110	0.822	nucleoside diphosphate phosphatase activity
GO:0005347	0.819	ATP transmembrane transporter activity
GO:0005488	0.751	binding
GO:0015217	0.746	ADP transmembrane transporter activity
GO:0005515	0.661	protein binding
GO:0043167	0.370	ion binding
GO:0005342	0.364	organic acid transmembrane transporter activity
GO:0046943	0.337	carboxylic acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0015748	0.989	organophosphate ester transport
GO:0015931	0.976	nucleobase-containing compound transport
GO:0051503	0.971	adenine nucleotide transport
GO:1901264	0.918	carbohydrate derivative transport
GO:0055085	0.903	transmembrane transport
GO:0015711	0.880	organic anion transport
GO:0015868	0.696	purine ribonucleotide transport
GO:0065007	0.319	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.947	membrane
GO:0005634	0.920	nucleus
GO:0031090	0.325	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.995	Hydrolases.
EC:3.6.-.-	0.990	Acting on acid anhydrides.
EC:3.6.1.-	0.830	In phosphorus-containing anhydrides.
RHEA:36799	0.822	a ribonucleoside 5'-diphosphate + H2O = a ribonucleoside 5'-phosphate + H(+) + phosphate
EC:3.6.1.6	0.822	nucleoside diphosphate phosphatase.

[back to server]