StarFunc result for job id Q86VD9

User Input

>input (579 residues)
MQICGSSVASVAAGTSFQVLGPVCWQQLDLKMAVRVLWGGLSLLRVLWCLLPQTGYVHPD
EFFQSPEVMAEDILGVQAARPWEFYPSSSCRSVLFPLLISGSTFWLLRLWEELGPWPGLV
SGYALLVGPRLLLTALSFALDGAVYHLAPPMGADRWNALALLSGSYVTLVFYTRTFSNTI
EGLLFTWLLVLVSSHVTWGPTRKEPAPGPRWRSWLLGGIVAAGFFNRPTFLAFAVVPLYL
WGTRGATNPGLKSLTREALVLLPGAALTAAVFVATDSWYFSSPATSRNLVLTPVNFLHYN
LNPQNLARHGTHARLTHLAVNGFLLFGVLHAQALQAAWQRLQVGLQASAQMGLLRALGAR
SLLSSPRSYLLLLYFMPLALLSAFSHQEARFLIPLLVPLVLLCSPQTQPVPWKGTVVLFN
ALGALLFGCLHQGGLVPGLEYLEQVVHAPVLPSTPTHYTLLFTHTYMPPRHLLHLPGLGA
PVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKN
ETLLFPHLTLEDPPALSSLLSGAWRDHLSLHIVELGEET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VD9	1.000	1.000	2.108E-86	579	1.000	1.000	Q86VD9.pdb.gz	PIGZ_HUMAN GPI mannosyltransferase 4 OS=Homo sapiens OX=9606 GN=PIGZ PE=2 SV=4
2	AFDB:Q09837	0.725	0.783	1.686E-25	533	0.216	0.235	Q09837.pdb.gz	SMP3_SCHPO GPI mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smp3 PE=3 SV=1
3	AFDB:Q04174	0.693	0.772	8.419E-22	516	0.252	0.283	Q04174.pdb.gz	SMP3_YEAST GPI mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMP3 PE=1 SV=3
4	AFDB:Q4WPG0	0.683	0.526	1.281E-15	771	0.228	0.171	Q4WPG0.pdb.gz	GPI10_ASPFU GPI mannosyltransferase 3 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gpi10 PE=3 SV=1
5	AFDB:Q92521	0.653	0.680	5.802E-14	554	0.199	0.208	Q92521.pdb.gz	PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
6	AFDB:Q94A15	0.650	0.684	5.802E-14	548	0.200	0.212	Q94A15.pdb.gz	APTG1_ARATH Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
7	AFDB:Q9JJQ0	0.634	0.672	1.006E-13	542	0.204	0.218	Q9JJQ0.pdb.gz	PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
8	AFDB:P86935	0.604	0.624	3.742E-13	558	0.187	0.194	P86935.pdb.gz	GPI10_TRYBB GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei OX=5702 GN=GPI10 PE=2 SV=1
9	AFDB:Q9USN0	0.637	0.717	9.110E-13	506	0.166	0.190	Q9USN0.pdb.gz	GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi10 PE=3 SV=1
10	AFDB:Q8IDS3	0.638	0.487	2.589E-11	786	0.149	0.109	Q8IDS3.pdb.gz	Q8IDS3_PLAF7 Mannosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1341600 PE=3 SV=1
11	PDB:6eznF	0.432	0.395	7.625E-4	650	0.079	0.071	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
12	PDB:6s7tA	0.382	0.327	3.814E-3	706	0.109	0.089	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
13	PDB:6p25A	0.293	0.239	3.979E-3	731	0.064	0.051	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
14	PDB:5oglA	0.366	0.314	5.585E-3	707	0.128	0.105	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
15	PDB:6p25B	0.307	0.263	1.054E-2	690	0.064	0.054	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
16	PDB:7bvfA	0.378	0.220	1.039E-1	1087	0.104	0.055	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
17	PDB:6wbvA	0.097	0.120	1.131E-1	429	0.109	0.147	6wbvA.pdb.gz	Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms.
18	PDB:7cmuR	0.101	0.180	1.587E-1	272	0.064	0.136	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
19	PDB:5ucoA	0.133	0.186	2.227E-1	377	0.038	0.058	5ucoA.pdb.gz
20	PDB:6gw3A	0.114	0.155	3.126E-1	383	0.041	0.063	6gw3A.pdb.gz	Structure of a PKS class III from Cannabis sativa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VD9	0.0	1149	579	1.000	1.000	PIGZ_HUMAN GPI mannosyltransferase 4 OS=Homo sapiens OX=9606 GN=PIGZ PE=2 SV=4
2	Q09837	1.98e-31	130	533	0.192	0.208	SMP3_SCHPO GPI mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smp3 PE=3 SV=1
3	Q04174	1.07e-30	128	516	0.218	0.244	SMP3_YEAST GPI mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMP3 PE=1 SV=3
4	Q94A15	7.81e-06	51.2	548	0.157	0.166	APTG1_ARATH Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
5	Q9USN0	1.18e-04	47.4	506	0.105	0.121	GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi10 PE=3 SV=1
6	Q92521	0.005	42.0	554	0.083	0.087	PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
7	Q9VBV8	0.070	38.5	623	0.086	0.080	Q9VBV8_DROME Mannosyltransferase OS=Drosophila melanogaster OX=7227 GN=Alg9 PE=2 SV=1
8	Q9JJQ0	0.14	37.4	542	0.081	0.087	PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
9	Q4WPG0	0.19	37.0	771	0.207	0.156	GPI10_ASPFU GPI mannosyltransferase 3 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gpi10 PE=3 SV=1
10	Q6FIN8	2.3	32.7	211	0.028	0.076	PUP1_CANGA PDR1 up-regulated protein 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PUP1 PE=2 SV=1
11	Q8IDS3	3.5	33.1	786	0.035	0.025	Q8IDS3_PLAF7 Mannosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1341600 PE=3 SV=1
12	A0AVT1	8.2	32.0	1052	0.031	0.017	UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03901 Glyco_transf_22	2.4e-54	196.8	Alg9-like mannosyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363260	0.892	GPI mannosyltransferase 2
2	9606.ENSP00000357069	0.881	GPI mannosyltransferase 1
3	9606.ENSP00000367880	0.838	GPI ethanolamine phosphate transferase 3
4	9606.ENSP00000347206	0.802	Glycosylphosphatidylinositol anchor attachment 1 protein
5	9606.ENSP00000333813	0.777	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
6	9606.ENSP00000415203	0.730	GPI ethanolamine phosphate transferase 2
7	9606.ENSP00000482396	0.728	Alpha-1,2-mannosyltransferase ALG9
8	9606.ENSP00000482437	0.728	Mannosyltransferase
9	9606.ENSP00000026218	0.725	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
10	9606.ENSP00000350263	0.719	GPI ethanolamine phosphate transferase 1
11	9606.ENSP00000420037	0.688	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
12	9606.ENSP00000225609	0.672	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
13	9606.ENSP00000356702	0.668	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
14	9606.ENSP00000369820	0.665	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
15	9606.ENSP00000465894	0.660	Metallophosphoesterase 1
16	9606.ENSP00000281382	0.633	Phosphatidylinositol-glycan biosynthesis class F protein
17	9606.ENSP00000266483	0.615	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
18	9606.ENSP00000310120	0.608	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
19	9606.ENSP00000363984	0.608	Transmembrane protein 246
20	9606.ENSP00000482202	0.600	Phosphatidylinositol-glycan biosynthesis class W protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000026	1.000	alpha-1,2-mannosyltransferase activity
GO:0005488	0.657	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901137	0.989	carbohydrate derivative biosynthetic process
GO:1901566	0.989	organonitrogen compound biosynthetic process
GO:0036211	0.989	protein modification process
GO:0034645	0.989	cellular macromolecule biosynthetic process
GO:0044255	0.976	cellular lipid metabolic process
GO:0046467	0.920	membrane lipid biosynthetic process
GO:0009247	0.876	glycolipid biosynthetic process
GO:0006506	0.870	GPI anchor biosynthetic process
GO:0016254	0.389	preassembly of GPI anchor in ER membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]