StarFunc result for job id Q86VF2

User Input

>input (1251 residues)
MAGKLRKSHIPGVSIWQLVEEIPEGCSTPDFEQKPVTSALPEGKNAVFRAVVCGEPRPEV
RWQNSKGDLSDSSKYKISSSPGSKEHVLQINKLTGEDTDLYRCTAVNAYGEAACSVRLTV
IEVGFRKNRKRHREPQEDLRKELMDFRKLLKKRAPPAPKKKMDLEQIWQLLMTADRKDYE
KICLKYGIVDYRGMLRRLQEMKKEQEDKMAQYINTISSLRHIRVTKDGNAKFDLELDLKD
SQSKIYLYKDGEMIPYGFNNQTKHCLRRLGKRYEFQIQDLRPEDSGIYQVKVEDAVVFST
ELEASAIPPRVVVPLAETHCEEQGDAVFECTLSSPCPSAAWHFRHRLLHPSDKYEVYVSP
DGLTHRLVVRGARFSDMGPYSLGTGLYTSSAWLVVEAGKDKDLQSTSADHKLQSRRSGKD
GRLDIYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLT
SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV
QDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVD
LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAG
VCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVR
AVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI
ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD
PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVP
VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV
KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVV
LRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR
SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR
FTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN
PAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VF2	1.000	1.000	0.000	1251	1.000	1.000	Q86VF2.pdb.gz	IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IGFN1 PE=1 SV=2
2	AFDB:E7EZ79	0.173	0.171	2.777E-85	1266	0.244	0.241	E7EZ79.pdb.gz
3	AFDB:P56741	0.204	0.201	3.436E-84	1274	0.236	0.232	P56741.pdb.gz	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
4	AFDB:P16419	0.208	0.226	3.597E-84	1132	0.249	0.275	P16419.pdb.gz	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
5	AFDB:Q90688	0.172	0.170	3.765E-84	1272	0.234	0.230	Q90688.pdb.gz	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
6	AFDB:A0A1L1QZU5	0.179	0.175	7.143E-84	1287	0.251	0.244	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
7	AFDB:Q14324	0.221	0.238	2.346E-83	1141	0.234	0.257	Q14324.pdb.gz	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
8	AFDB:A6QP89	0.155	0.161	4.451E-83	1198	0.245	0.255	A6QP89.pdb.gz	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
9	AFDB:Q5U3B1	0.181	0.192	8.839E-83	1168	0.245	0.262	Q5U3B1.pdb.gz	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
10	AFDB:F1R6I7	0.215	0.238	9.686E-83	1111	0.235	0.265	F1R6I7.pdb.gz
11	PDB:1e07A	0.125	0.201	7.142E-22	642	0.076	0.148	1e07A.pdb.gz
12	PDB:5oj2B	0.140	0.200	1.783E-21	692	0.102	0.184	5oj2B.pdb.gz
13	PDB:7sqcO0	0.118	0.126	1.575E-16	1140	0.091	0.100	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.086	0.073	2.169E-16	1597	0.102	0.080	5a42A.pdb.gz
15	PDB:7q5zA	0.108	0.102	1.436E-13	1344	0.070	0.065	7q5zA.pdb.gz
16	PDB:7vonA	0.093	0.086	3.424E-13	1399	0.060	0.054	7vonA.pdb.gz
17	PDB:7q1yA	0.103	0.097	4.303E-13	1374	0.069	0.063	7q1yA.pdb.gz
18	PDB:6h03A	0.095	0.097	2.682E-12	1223	0.083	0.085	6h03A.pdb.gz
19	PDB:7nycA	0.082	0.073	2.938E-12	1542	0.067	0.054	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4ziqA	0.088	0.079	4.435E-12	1450	0.075	0.065	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3KNY0	0.0	1360	2849	0.524	0.230	IGFN1_MOUSE Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Mus musculus OX=10090 GN=Igfn1 PE=1 SV=3
2	Q86VF2	0.0	2577	1251	1.000	1.000	IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IGFN1 PE=1 SV=2
3	Q8WZ42	7.14e-88	318	34350	0.152	0.006	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
4	A2ASS6	2.08e-87	316	35213	0.152	0.005	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
5	A0A8I5ZUN3	2.71e-86	313	35375	0.152	0.005	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
6	A0A8I5ZU83	2.76e-86	313	26931	0.152	0.007	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
7	L0MN91	6.46e-69	258	8866	0.135	0.019	L0MN91_DROME Bent, isoform I OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
8	D1YSG0	7.06e-69	258	8933	0.135	0.019	D1YSG0_DROME Bent, isoform F OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
9	X2JD89	7.94e-69	258	8602	0.135	0.020	X2JD89_DROME Bent, isoform J OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
10	L0MPZ1	8.64e-69	258	8408	0.135	0.020	L0MPZ1_DROME Bent, isoform H OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
11	Q7KQP6	9.22e-69	258	8648	0.135	0.020	Q7KQP6_DROME Bent, isoform C OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
12	Q14324	1.26e-68	254	1141	0.180	0.197	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
13	A0A1L1QZU5	1.83e-68	255	1287	0.177	0.172	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
14	P16419	4.73e-68	253	1132	0.176	0.194	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
15	O76281	1.74e-67	254	6658	0.134	0.025	O76281_DROME Projectin (Fragment) OS=Drosophila melanogaster OX=7227 GN=bt PE=3 SV=1
16	Q5XKE0	6.79e-67	249	1136	0.177	0.195	MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus musculus OX=10090 GN=Mybpc2 PE=1 SV=1
17	Q6P6L5	1.41e-65	245	1124	0.170	0.190	Q6P6L5_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
18	A0A571BEN1	2.07e-65	244	1139	0.170	0.187	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
19	D3YU50	2.11e-65	244	1127	0.170	0.189	D3YU50_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
20	A6QP89	5.59e-63	237	1198	0.173	0.180	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	0.22	22.9	CD80-like C2-set immunoglobulin domain
2	PF00041 fn3	3.6e-51	182.8	Fibronectin type III domain
3	PF07679 I-set	4.4e-75	259.2	Immunoglobulin I-set domain
4	PF00047 ig	2.7e-24	96.5	Immunoglobulin domain
5	PF13895 Ig_2	2.1e-18	77.7	Immunoglobulin domain
6	PF13927 Ig_3	7.5e-48	172.3	Immunoglobulin domain
7	PF16706 Izumo-Ig	2e+02	13.3	Izumo-like Immunoglobulin domain
8	PF16655 PhoD_N	31	16.5	PhoD-like phosphatase, N-terminal domain
9	PF16656 Pur_ac_phosph_N	0.15	24.1	Purple acid Phosphatase, N-terminal domain
10	PF11465 Receptor_2B4	2.3e+02	13.4	Natural killer cell receptor 2B4
11	PF18362 THB	2e-15	67.3	Tri-helix bundle domain
12	PF01108 Tissue_fac	6.3	18.1	Tissue factor
13	PF07686 V-set	3.1e-12	58.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000021663

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006559	0.715	Calmodulin-like 5
2	9593.ENSGGOP00000028342	0.661	MSS51 mitochondrial translational activator
3	9593.ENSGGOP00000019457	0.613	Actin, alpha, cardiac muscle 1
4	9593.ENSGGOP00000006954	0.567	Titin-cap
5	9593.ENSGGOP00000020774	0.563	Uncharacterized protein
6	9593.ENSGGOP00000021479	0.563	Filamin C, gamma
7	9593.ENSGGOP00000016927	0.534	Tryptophan hydroxylase 1
8	9593.ENSGGOP00000016225	0.525	Coiled-coil domain containing 8
9	9593.ENSGGOP00000018250	0.519	Uncharacterized protein
10	9593.ENSGGOP00000025093	0.516	Myosin, heavy chain 10, non-muscle
11	9593.ENSGGOP00000028733	0.504	Uncharacterized protein
12	9593.ENSGGOP00000010283	0.503	Cullin 7
13	9593.ENSGGOP00000003975	0.500	Uncharacterized protein
14	9593.ENSGGOP00000026982	0.500	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.702	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.528	biological regulation
GO:0009987	0.485	cellular process
GO:0032501	0.340	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030017	0.997	sarcomere
GO:0005829	0.969	cytosol
GO:0005856	0.911	cytoskeleton
GO:0031672	0.476	A band
GO:0043227	0.463	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]