StarFunc result for job id Q86VF7

User Input

>input (1730 residues)
MNVQPCSRCGYGVYPAEKISCIDQIWHKACFHCEVCKMMLSVNNFVSHQKKPYCHAHNPK
NNTFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQCKSVFHWDMKSKDKEGAPNRQPLANE
RAYWTGYGEGNAWCPGALPDPEIVRMVEARKSLGEEYTEDYEQPRGKGSFPAMITPAYQR
AKKANQLASQVEYKRGHDERISRFSTVVDTPELLRSKAGAQLQSDVRYTEDYEQQRGKGS
FPAMITPAYQIAKRANELASDVRYHQQYQKEMRGMAGPAIGAEGILTRECADQYGQGYPE
EYEEHRGKGSFPAMITPAYQNAKKAHELASDIKYRQDFNKMKGAAHYHSLPAQDNLVLKQ
AQSVNKLVSEVEYKKDLESSRGHSINYCETPQFRNVSKISKFTSDNKYKENYQNHMRGRY
EGVGMDRRTLHAMKVGSLASNVAYKADYKHDIVDYNYPATLTPSYQTAMKLVPLKDANYR
QSIDKLKYSSVTDTPQIVQAKINAQQLSHVNYRADYEKNKLNYTLPQDVPQLVKAKTNAK
LFSEVKYKEGWEKTKGKGFEMKLDAMSLLAAKASGELASNIKYKEEYEKTKGKAMGTADS
RLLHSLQIAKMSSEVEYKKGFEESKTRFHLPMDMVNIRHAKKAQTLASDLDYRKKLHEYT
VLPEDMKTQWAKKAYGLQSELQYKADLAWMKGVGWLTEGSLNLEQAKKAGQLVSEKNYRQ
RVDELKFTSVTDSSQMEHAKKSQELQSGVAYKAGNEQSVHQYTISKDEPLFLQARANAAN
LSEKLYKSSWENQKAKGFELRLDSLTFLAAKAKRDLASEVKYKEDYERSRGKLIGAKDVQ
GDSQMSHSLQMSKLQSELEYKKGFEDTKSQCHVSLDMVHLVHARKAQHLATDVGYKTAEH
HFTALPTDMKVEWAKKAYGLQSDNQYRADVKWMKGMGWVATGSLNVEQAKKAGELISEKK
YRQHPDALKFTSIKDTPEMVQARISYTQAVDRLYREQGENIKHHYTPTADLPEVLLAKLN
AMNISETRYKESWSKLRDGGYKLRLDALPFQAAKASGEIISDYKYKEAFEKMKGQMLGSR
SLEDDISLAHSVYATSLQSDVNYKKGFEHSKAQFHLPLDMAALVHAKKAQTLASNQDYKH
PLPQYTSLAEDLRLSCAKKAHKLQSENLYRSDLNFMRGVACVIPGTLEIEGRKKASELIS
ESKYRQHPHSFKYTAVTDTPNLLHAKFSNQITNERLYKAAGEDARHEYTMTLGLPEFIRA
KTNAANLSDARYKESWRNLRAQGYKLTIEALPFQAARASGDIASDFLYRHDFVKERGKLI
GPQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHD
YRTQYHKFTALPEDLKMAWAKKAHALQSELRYKSDLIGMKGIGWLALRSPQMESAKKAGE
LISETKYRKKPDSIKFTTVVDSPDLVHAKNSYMHCNERMYRSGDAESLHRYTLIPDHPDF
TRARLNALHLSDKVYRNSWEQTRAGSYDFRLDAIPFQTARASREIASDFRYKEAFLRDRG
LQIGYRSVDDDPRMKHFLNVGRLQSDNEYKKDFAKSRSQFHSSTDQPGLLQAKRSQQLAS
DVHYRQPLPQPTCDPEQLGLRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARR
AAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKALLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80XB4	0.217	0.218	0.000	1728	0.861	0.862	Q80XB4.pdb.gz	NRAP_MOUSE Nebulin-related-anchoring protein OS=Mus musculus OX=10090 GN=Nrap PE=1 SV=3
2	AFDB:Q86VF7	1.000	1.000	0.000	1730	1.000	1.000	Q86VF7.pdb.gz	NRAP_HUMAN Nebulin-related-anchoring protein OS=Homo sapiens OX=9606 GN=NRAP PE=1 SV=2
3	AFDB:Q62412	0.090	0.110	3.009E-61	1190	0.283	0.412	Q62412.pdb.gz	Q62412_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=2 SV=1
4	AFDB:Q9DEG5	0.093	0.125	1.986E-40	1042	0.206	0.343	Q9DEG5.pdb.gz	Q9DEG5_CHICK Nebulin (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
5	AFDB:O76041	0.053	0.076	4.703E-15	1014	0.125	0.214	O76041.pdb.gz	NEBL_HUMAN Nebulette OS=Homo sapiens OX=9606 GN=NEBL PE=1 SV=1
6	AFDB:A0A1B0GSF5	0.049	0.102	1.376E-11	529	0.075	0.244	A0A1B0GSF5.pdb.gz	A0A1B0GSF5_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
7	AFDB:B0UY60	0.036	0.125	4.692E-7	387	0.054	0.240	B0UY60.pdb.gz
8	AFDB:F1RA39	0.036	0.044	4.456E-5	1413	0.058	0.071	F1RA39.pdb.gz	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
9	AFDB:Q6Q6R3	0.044	0.219	4.936E-5	243	0.032	0.226	Q6Q6R3.pdb.gz	CRIP3_MOUSE Cysteine-rich protein 3 OS=Mus musculus OX=10090 GN=Crip3 PE=2 SV=2
10	AFDB:B0R107	0.037	0.140	2.176E-4	427	0.029	0.119	B0R107.pdb.gz	B0R107_DANRE LIM homeobox 2b OS=Danio rerio OX=7955 GN=bel PE=4 SV=1
11	PDB:1imlA	0.035	0.595	1.435E-3	76	0.013	0.289	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
12	PDB:1b8tA	0.037	0.299	5.428E-3	192	0.015	0.135	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:4kfzB	0.029	0.312	1.761E-2	148	0.007	0.081	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
14	PDB:7sqkC	0.032	0.067	3.602	600	0.047	0.137	7sqkC.pdb.gz
15	PDB:7d4iB6	0.027	0.086	6.323	377	0.034	0.156	7d4iB6.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
16	PDB:6puuA	0.027	0.034	7.758	1309	0.017	0.023	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
17	PDB:5nzrK	0.028	0.065	8.166	560	0.032	0.100	5nzrK.pdb.gz
18	PDB:7dcoL	0.033	0.086	8.166	435	0.030	0.120	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:3lutB	0.031	0.083	8.594	390	0.020	0.090	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096MK15	1007	7488	0.343	0.079	A0A096MK15_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=2
2	A0A571BF46	1089	7488	0.361	0.083	A0A571BF46_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
3	A0A571BF58	1089	7523	0.361	0.083	A0A571BF58_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
4	A0A8I5Y690	1008	7364	0.343	0.081	A0A8I5Y690_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
5	A0A8I5Y9I7	1008	7426	0.343	0.080	A0A8I5Y9I7_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
6	A0A8I5ZQE8	1008	7395	0.343	0.080	A0A8I5ZQE8_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
7	A0A8I5ZRN3	1008	7523	0.343	0.079	A0A8I5ZRN3_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
8	A0A8I6A1J2	1000	7008	0.343	0.085	A0A8I6A1J2_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
9	A0A8I6A8Q0	1001	7302	0.343	0.081	A0A8I6A8Q0_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
10	A0A8I6ASW0	1008	7364	0.343	0.081	A0A8I6ASW0_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
11	A0A8I6G5A2	1000	7257	0.343	0.082	A0A8I6G5A2_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
12	A2AQA9	1090	6909	0.361	0.090	A2AQA9_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
13	A2AQB2	640	3044	0.266	0.151	A2AQB2_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
14	E9Q1W3	1089	7152	0.361	0.087	E9Q1W3_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
15	F1M1J2	1008	7457	0.343	0.080	F1M1J2_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=4
16	F6RDH3	747	1190	0.264	0.384	F6RDH3_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=1 SV=8
17	G1TDU6	1006	6666	0.340	0.088	G1TDU6_RABIT Nebulin OS=Oryctolagus cuniculus OX=9986 GN=NEB PE=4 SV=2
18	P20929	1003	6669	0.341	0.088	NEBU_HUMAN Nebulin OS=Homo sapiens OX=9606 GN=NEB PE=1 SV=5
19	Q62411	647	1358	0.240	0.306	Q62411_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=2 SV=1
20	Q62412	592	1190	0.217	0.315	Q62412_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17660 BTRD1	2.7e+02	12.8	Bacterial tandem repeat domain 1
2	PF00412 LIM	4.9e-05	34.8	LIM domain
3	PF00880 Nebulin	1.4e-189	622.6	Nebulin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358365

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284669	0.861	Kelch-like protein 41
2	9606.ENSP00000401437	0.738	LIM domain-binding protein 3
3	9606.ENSP00000439281	0.729	Triadin
4	9606.ENSP00000287777	0.724	Kelch-like protein 40
5	9606.ENSP00000467141	0.704	Titin
6	9606.ENSP00000217456	0.685	Adipocyte plasma membrane-associated protein
7	9606.ENSP00000327145	0.645	Filamin-C
8	9606.ENSP00000443495	0.630	Alpha-actinin-2
9	9606.ENSP00000306997	0.623	Myozenin-2
10	9606.ENSP00000411932	0.610	Leiomodin-2
11	9606.ENSP00000343140	0.605	Xin actin-binding repeat-containing protein 1
12	9606.ENSP00000312624	0.598	Telethonin
13	9606.ENSP00000239926	0.596	Myotilin
14	9606.ENSP00000431813	0.592	Cysteine and glycine-rich protein 3
15	9606.ENSP00000262113	0.585	Myomesin-2
16	9606.ENSP00000365131	0.577	Large proline-rich protein BAG6
17	9606.ENSP00000378289	0.573	Synaptopodin 2-like protein
18	9606.ENSP00000386840	0.571	Xin actin-binding repeat-containing protein 2
19	9606.ENSP00000393453	0.553	Histone-lysine N-methyltransferase SMYD1
20	9606.ENSP00000324422	0.552	Zyxin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.568	cytoskeletal protein binding
GO:0003779	0.490	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0030029	0.921	actin filament-based process
GO:0030036	0.910	actin cytoskeleton organization
GO:0065007	0.586	biological regulation
GO:0097435	0.549	supramolecular fiber organization
GO:0032502	0.536	developmental process
GO:0050789	0.505	regulation of biological process
GO:0048856	0.470	anatomical structure development
GO:0044085	0.388	cellular component biogenesis
GO:0050794	0.375	regulation of cellular process
GO:0009653	0.370	anatomical structure morphogenesis
GO:0022607	0.305	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030016	0.999	myofibril
GO:0030017	0.925	sarcomere
GO:0015629	0.876	actin cytoskeleton
GO:0030054	0.867	cell junction
GO:0005829	0.858	cytosol
GO:0070161	0.797	anchoring junction
GO:0030055	0.625	cell-substrate junction
GO:0031674	0.614	I band
GO:0043227	0.547	membrane-bounded organelle
GO:0043231	0.417	intracellular membrane-bounded organelle
GO:0005916	0.368	fascia adherens

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]