StarFunc result for job id Q86VH2

User Input

>input (1401 residues)
MEEIPVKVAVRIRPLLCKEALHNHQVCVRVIPNSQQVIIGRDRVFTFDFVFGKNSTQDEV
YNTCIKPLVLSLIEGYNATVFAYGQTGSGKTYTIGGGHIASVVEGQKGIIPRAIQEIFQS
ISEHPSIDFNVKVSYIEVYKEDLRDLLELETSMKDLHIREDEKGNTVIVGAKECHVESAG
EVMSLLEMGNAARHTGTTQMNEHSSRSHAIFTISICQVHKNMEAAEDGSWYSPRHIVSKF
HFVDLAGSERVTKTGNTGERFKESIQINSGLLALGNVISALGDPRRKSSHIPYRDAKITR
LLKDSLGGSAKTVMITCVSPSSSNFDESLNSLKYANRARNIRNKPTVNFSPESDRIDEME
FEIKLLREALQSQQAGVSQTTQINREGSPDTNRIHSLEEQVAQLQGECLGYQCCVEEAFT
FLVDLKDTVRLNEKQQHKLQEWFNMIQEVRKAVLTSFRGIGGTASLEEGPQHVTVLQLKR
ELKKCQCVLAADEVVFNQKELEVKELKNQVQMMVQENKGHAVSLKEAQKVNRLQNEKIIE
QQLLVDQLSEELTKLNLSVTSSAKENCGDGPDARIPERRPYTVPFDTHLGHYIYIPSRQD
SRKVHTSPPMYSLDRIFAGFRTRSQMLLGHIEEQDKVLHCQFSDNSDDEESEGQEKSGTR
CRSRSWIQKPDSVCSLVELSDTQDETQKSDLENEDLKIDCLQESQELNLQKLKNSERILT
EAKQKMRELTINIKMKEDLIKELIKTGNDAKSVSKQYSLKVTKLEHDAEQAKVELIETQK
QLQELENKDLSDVAMKVKLQKEFRKKMDAAKLRVQVLQKKQQDSKKLASLSIQNEKRANE
LEQSVDHMKYQKIQLQRKLREENEKRKQLDAVIKRDQQKIKEIQLKTGQEEGLKPKAEDL
DACNLKRRKGSFGSIDHLQKLDEQKKWLDEEVEKVLNQRQELEELEADLKKREAIVSKKE
ALLQEKSHLENKKLRSSQALNTDSLKISTRLNLLEQELSEKNVQLQTSTAEEKTKISEQV
EVLQKEKDQLQKRRHNVDEKLKNGRVLSPEEEHVLFQLEEGIEALEAAIEYRNESIQNRQ
KSLRASFHNLSRGEANVLEKLACLSPVEIRTILFRYFNKVVNLREAERKQQLYNEEMKMK
VLERDNMVRELESALDHLKLQCDRRLTLQQKEHEQKMQLLLHHFKEQDGEGIMETFKTYE
DKIQQLEKDLYFYKKTSRDHKKKLKELVGEAIRRQLAPSEYQEAGDGVLKPEGGGMLSEE
LKWASRPESMKLSGREREMDSSASSLRTQPNPQKLWEDIPELPPIHSSLAPPSGHMLGNE
NKTETDDNQFTKSHSRLSSQIQVVGNVGRLHGVTPVKLCRKELRQISALELSLRRSSLGV
GIGSMAADSIEVSRKPRDLKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7M6Z4	0.326	0.328	0.000	1394	0.785	0.789	Q7M6Z4.pdb.gz	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
2	AFDB:Q86VH2	1.000	1.000	0.000	1401	1.000	1.000	Q86VH2.pdb.gz	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
3	AFDB:Q2M1P5	0.289	0.300	1.297E-87	1343	0.398	0.415	Q2M1P5.pdb.gz	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
4	AFDB:B7ZNG0	0.253	0.261	2.128E-87	1348	0.382	0.397	B7ZNG0.pdb.gz	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
5	AFDB:Q58G59	0.262	0.268	2.803E-87	1363	0.401	0.412	Q58G59.pdb.gz	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
6	AFDB:Q7Z4S6	0.244	0.206	9.898E-60	1674	0.258	0.216	Q7Z4S6.pdb.gz	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
7	AFDB:Q9QXL1	0.252	0.213	1.377E-59	1668	0.252	0.212	Q9QXL1.pdb.gz	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
8	AFDB:P33174	0.240	0.273	3.824E-56	1231	0.220	0.250	P33174.pdb.gz	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
9	AFDB:Q2VIQ3	0.253	0.286	3.824E-56	1234	0.230	0.261	Q2VIQ3.pdb.gz	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
10	AFDB:Q9XZ29	0.242	0.280	5.242E-52	1212	0.211	0.243	Q9XZ29.pdb.gz	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
11	PDB:7wrgA	0.226	0.384	1.829E-30	812	0.098	0.169	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.220	0.387	2.870E-29	783	0.099	0.178	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.194	0.396	1.942E-24	670	0.073	0.152	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:3jcfA	0.061	0.146	2.703E-2	349	0.030	0.120	3jcfA.pdb.gz
15	PDB:7rroD1	0.077	0.210	7.696E-2	425	0.039	0.129	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:7ungA1	0.071	0.187	1.132E-1	391	0.042	0.151	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:7rroA1	0.074	0.183	1.335E-1	396	0.039	0.136	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7vhpG	0.054	0.148	1.410E-1	299	0.031	0.144	7vhpG.pdb.gz
19	PDB:5w3sA	0.043	0.099	1.664E-1	485	0.036	0.103	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
20	PDB:5j6hA	0.036	0.131	2.074E-1	275	0.007	0.036	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7M6Z4	0.0	2219	1394	0.786	0.790	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
2	Q86VH2	0.0	2871	1401	1.000	1.000	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
3	Q58G59	1.35e-167	540	1363	0.206	0.212	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
4	Q2M1P5	1.17e-150	494	1343	0.191	0.199	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
5	B7ZNG0	4.04e-146	482	1348	0.192	0.200	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
6	Q7Z4S6	3.44e-106	374	1674	0.134	0.112	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
7	A0A1B0GV47	4.65e-106	373	1653	0.133	0.113	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
8	O95239	6.38e-105	365	1232	0.127	0.144	KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3
9	P33174	1.61e-104	363	1231	0.126	0.144	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
10	O75037	1.71e-103	365	1637	0.137	0.117	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
11	Q2VIQ3	3.18e-103	360	1234	0.128	0.145	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
12	Q9QXL1	3.13e-102	362	1668	0.136	0.115	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
13	Q6YUL8	3.34e-101	350	1035	0.136	0.184	KN4A_ORYSJ Kinesin-like protein KIN-4A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN4A PE=1 SV=1
14	Q8GS71	7.94e-101	349	1035	0.136	0.184	KN4A_ARATH Kinesin-like protein KIN-4A OS=Arabidopsis thaliana OX=3702 GN=KIN4A PE=1 SV=1
15	A0A068FIK2	9.40e-101	348	1033	0.133	0.180	KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium hirsutum OX=3635 GN=KIN4A PE=2 SV=1
16	P46873	1.13e-93	320	699	0.126	0.253	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
17	F4K0J3	3.25e-93	332	1300	0.152	0.164	KN4C_ARATH Kinesin-like protein KIN-4C OS=Arabidopsis thaliana OX=3702 GN=KIN4C PE=2 SV=2
18	Q19633	8.50e-93	320	782	0.124	0.223	Q19633_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-11 PE=1 SV=2
19	P46871	1.02e-85	298	742	0.120	0.226	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
20	O15066	1.74e-85	298	747	0.119	0.224	KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	1.3e-107	371.2	Kinesin motor domain
2	PF16796 Microtub_bd	6.4e-19	79.9	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297814

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354560	0.875	Kinesin-associated protein 3
2	9606.ENSP00000249373	0.849	Smoothened homolog
3	9606.ENSP00000295709	0.790	Serine/threonine-protein kinase 36
4	9606.ENSP00000379258	0.760	Transcriptional activator GLI3
5	9606.ENSP00000260731	0.748	Kinesin-like protein KIF11
6	9606.ENSP00000228682	0.745	Zinc finger protein GLI1
7	9606.ENSP00000260363	0.702	Kinesin-like protein KIF23
8	9606.ENSP00000404190	0.696	Rac GTPase-activating protein 1
9	9606.ENSP00000385334	0.680	Mitotic spindle assembly checkpoint protein MAD1
10	9606.ENSP00000238379	0.675	Haloacid dehalogenase like hydrolase domain containing 3
11	9606.ENSP00000331682	0.672	Kelch-like protein 22
12	9606.ENSP00000390436	0.670	Zinc finger protein GLI2
13	9606.ENSP00000287598	0.637	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
14	9606.ENSP00000408979	0.635	Kinesin heavy chain isoform 5A
15	9606.ENSP00000417518	0.629	CLIP-associating protein 2
16	9606.ENSP00000278935	0.628	Centrosomal protein of 164 kDa
17	9606.ENSP00000358918	0.628	Suppressor of fused homolog
18	9606.ENSP00000307078	0.625	Kinesin-1 heavy chain
19	9606.ENSP00000375810	0.616	Kinesin light chain 3
20	9606.ENSP00000378356	0.610	Kinesin-like protein KIF20A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003774	0.676	cytoskeletal motor activity
GO:0003777	0.496	microtubule motor activity
GO:0008092	0.359	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.976	cellular component organization or biogenesis
GO:0016043	0.973	cellular component organization
GO:0032501	0.971	multicellular organismal process
GO:0032502	0.963	developmental process
GO:0048856	0.952	anatomical structure development
GO:0044085	0.952	cellular component biogenesis
GO:0051641	0.948	cellular localization
GO:0007017	0.944	microtubule-based process
GO:0006996	0.918	organelle organization
GO:0007275	0.870	multicellular organism development
GO:0051234	0.856	establishment of localization
GO:0006810	0.754	transport
GO:0048731	0.719	system development
GO:0099111	0.580	microtubule-based transport
GO:0022607	0.572	cellular component assembly
GO:0050789	0.555	regulation of biological process
GO:0051649	0.522	establishment of localization in cell
GO:0050794	0.518	regulation of cellular process
GO:0007018	0.518	microtubule-based movement
GO:0007399	0.510	nervous system development
GO:0070925	0.384	organelle assembly
GO:0000226	0.353	microtubule cytoskeleton organization
GO:0007049	0.315	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005622	0.997	intracellular anatomical structure
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0005829	0.954	cytosol
GO:0005929	0.946	cilium
GO:0015630	0.875	microtubule cytoskeleton
GO:0032991	0.870	protein-containing complex
GO:0005634	0.852	nucleus
GO:0016020	0.413	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]