StarFunc result for job id Q86VI3

User Input

>input (1631 residues)
MERRAAGPGWAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVEDTLAALQNPSALLENL
REPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLNSDREQKAQELGLVELLEKEEV
QAGVAAANTKGDQEQAMLHAVQRINKAIRRRVAADTVKELMCPEAQLPPVYPVASSMYQL
ELAVLQQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGEN
AQRYFDALLKLRQERGMGEDFLSWNDLQATVSQVNAQTQEETDRVLAVSLINEALDKGSP
EKTLSALLLPAAGLDDVSLPVAPRYHLLLVAAKRQKAQVTGDPGAVLWLEEIRQGVVRAN
QDTNTAQRMALGVAAINQAIKEGKAAQTERVLRNPAVALRGVVPDCANGYQRALESAMAK
KQRPADTAFWVQHDMKDGTAYYFHLQTFQGIWEQPPGCPLNTSHLTREEIQSAVTKVTAA
YDRQQLWKANVGFVIQLQARLRGFLVRQKFAEHSHFLRTWLPAVIKIQAHWRGYRQRKIY
LEWLQYFKANLDAIIKIQAWARMWAARRQYLRRLHYFQKNVNSIVKIQAFFRARKAQDDY
RILVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMDI
KIGLLVKNRITLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEKRQKLEAYQHLF
YLLQTQPIYLAKLIFQMPQNKTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEIKS
KVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDKVLSVHTDPVHLYK
NWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDIALRNLLAMTDKFLLAITSSVDQI
PYGMRYVAKVLKATLAEKFPDATDSEVYKVVGNLLYYRFLNPAVVAPDAFDIVAMAAGGA
LAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPEPE
ERFAVDEYSDMVAVAKPMVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLEDLGELPT
IPDLIGESIAADGHTDLSKLEVSLTLTNKFEGLEADADDSNTRSLLLSTKQLLADIIQFH
PGDTLKEILSLSASREQEAAHKQLMSRRQACTAQTPEPLRRHRSLTAHSLLPLAEKQRRV
LRNLRRLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTKTTF
YEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPASHFR
NVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNLL
IFLLNKKFLRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KFQ1	0.835	0.832	0.000	1639	0.589	0.586	A0A0G2KFQ1.pdb.gz
2	AFDB:A2CE93	0.324	0.317	0.000	1680	0.533	0.517	A2CE93.pdb.gz	A2CE93_DANRE IQ motif-containing GTPase-activating protein 2 OS=Danio rerio OX=7955 GN=fc20f09 PE=1 SV=1
3	AFDB:F8VQ29	0.466	0.466	0.000	1632	0.852	0.852	F8VQ29.pdb.gz	F8VQ29_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
4	AFDB:G3V7Q7	0.805	0.793	0.000	1657	0.591	0.582	G3V7Q7.pdb.gz	G3V7Q7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
5	AFDB:Q13576	0.373	0.384	0.000	1575	0.502	0.520	Q13576.pdb.gz	IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4
6	AFDB:Q3UQ44	0.589	0.608	0.000	1575	0.496	0.514	Q3UQ44.pdb.gz	IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus OX=10090 GN=Iqgap2 PE=1 SV=2
7	AFDB:Q86VI3	1.000	1.000	0.000	1631	1.000	1.000	Q86VI3.pdb.gz	IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2
8	AFDB:O14188	0.226	0.247	2.266E-51	1489	0.239	0.261	O14188.pdb.gz	IQG1_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rng2 PE=1 SV=1
9	AFDB:Q54K32	0.358	0.664	7.021E-42	822	0.139	0.275	Q54K32.pdb.gz	RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum OX=44689 GN=rgaA PE=1 SV=1
10	AFDB:O00899	0.235	0.438	8.675E-39	860	0.129	0.244	O00899.pdb.gz	GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum OX=44689 GN=gapA PE=1 SV=1
11	PDB:7r04A	0.163	0.118	1.419E-10	2326	0.143	0.101	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
12	PDB:7pgrN	0.173	0.120	3.384E-10	2423	0.150	0.101	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
13	PDB:7r04B	0.141	0.104	2.912E-9	2229	0.112	0.082	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
14	PDB:7r03B	0.142	0.107	4.055E-9	2246	0.115	0.084	7r03B.pdb.gz
15	PDB:7mp5A	0.165	0.165	1.656E-8	1629	0.127	0.127	7mp5A.pdb.gz
16	PDB:1tr2B	0.056	0.074	1.416E-2	1029	0.072	0.114	1tr2B.pdb.gz
17	PDB:6r9tA	0.082	0.067	2.233E-2	2185	0.121	0.090	6r9tA.pdb.gz
18	PDB:6ig9T	0.065	0.044	3.241E-2	3386	0.117	0.056	6ig9T.pdb.gz
19	PDB:7w7gB	0.053	0.051	4.513E-2	1711	0.120	0.114	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
20	PDB:3w3zA	0.078	0.097	8.752E-2	1013	0.091	0.146	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YXJ2	0.0	1043	626	0.318	0.829	A0A0A6YXJ2_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
2	A0A0F7EVQ6	0.0	1971	1639	0.594	0.591	A0A0F7EVQ6_DANRE IQGAP3 protein OS=Danio rerio OX=7955 GN=IQGAP3 PE=1 SV=1
3	A0A8I6AJK7	0.0	1910	1638	0.589	0.587	A0A8I6AJK7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
4	A2CE93	0.0	1714	1680	0.531	0.515	A2CE93_DANRE IQ motif-containing GTPase-activating protein 2 OS=Danio rerio OX=7955 GN=fc20f09 PE=1 SV=1
5	A2RRC9	0.0	3343	1631	0.998	0.998	A2RRC9_HUMAN IQ motif containing GTPase activating protein 3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=1
6	A4QPB0	0.0	1967	1657	0.595	0.585	A4QPB0_HUMAN IQ motif containing GTPase activating protein 1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1
7	B5DFH1	0.0	1194	969	0.354	0.595	B5DFH1_RAT Iqgap1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=2 SV=1
8	B9EKT6	0.0	2814	1632	0.852	0.852	B9EKT6_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=2 SV=1
9	F1QAC1	0.0	1717	1673	0.530	0.517	F1QAC1_DANRE IQ motif-containing GTPase-activating protein 2 OS=Danio rerio OX=7955 GN=si:ch211-157p10.1 PE=1 SV=2
10	F6WBH7	0.0	1986	1657	0.599	0.590	F6WBH7_XENTR IQ motif-containing GTPase-activating protein 1 OS=Xenopus tropicalis OX=8364 GN=iqgap1 PE=4 SV=4
11	F8VQ29	0.0	2816	1632	0.853	0.852	F8VQ29_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
12	G3V7Q7	0.0	1940	1657	0.597	0.587	G3V7Q7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
13	K9IWF9	0.0	1945	1657	0.597	0.588	K9IWF9_PIG Ras GTPase-activating-like protein IQGAP1 OS=Sus scrofa OX=9823 GN=IQGAP1 PE=1 SV=1
14	P46940	0.0	1969	1657	0.595	0.586	IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1
15	Q13576	0.0	1245	1575	0.402	0.416	IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4
16	Q3UQ44	0.0	1246	1575	0.397	0.411	IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus OX=10090 GN=Iqgap2 PE=1 SV=2
17	Q3UQP1	0.0	1282	734	0.383	0.851	Q3UQP1_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
18	Q86VI3	0.0	3354	1631	1.000	1.000	IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2
19	Q9JKF1	0.0	1943	1657	0.597	0.587	IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus OX=10090 GN=Iqgap1 PE=1 SV=2
20	O14188	8.22e-99	353	1489	0.166	0.181	IQG1_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rng2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	77	14.5	CAMSAP CH domain
2	PF00307 CH	1.8e-15	68.4	Calponin homology (CH) domain
3	PF00612 IQ	7.2e-13	58.1	IQ calmodulin-binding motif
4	PF00616 RasGAP	5.8e-48	174.9	GTPase-activator protein for Ras-like GTPase
5	PF03836 RasGAP_C	2.3e-32	123.4	RasGAP C-terminus
6	PF03983 SHD1	43	15.4	SLA1 homology domain 1, SHD1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354451

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.979	Cell division control protein 42 homolog
2	9606.ENSP00000348461	0.972	Ras-related C3 botulinum toxin substrate 1
3	9606.ENSP00000261769	0.926	Cadherin-1
4	9606.ENSP00000344456	0.921	Catenin beta-1
5	9606.ENSP00000304669	0.902	Catenin alpha-1
6	9606.ENSP00000249071	0.901	Ras-related C3 botulinum toxin substrate 2
7	9606.ENSP00000337088	0.900	Menin
8	9606.ENSP00000378356	0.895	Kinesin-like protein KIF20A
9	9606.ENSP00000304283	0.892	Ras-related C3 botulinum toxin substrate 3
10	9606.ENSP00000414109	0.880	Holliday junction recognition protein
11	9606.ENSP00000479322	0.880	CAP-Gly domain-containing linker protein 1
12	9606.ENSP00000257934	0.859	Separin
13	9606.ENSP00000411532	0.853	DNA topoisomerase 2-alpha
14	9606.ENSP00000357643	0.817	Proliferation marker protein Ki-67
15	9606.ENSP00000268182	0.809	Ras GTPase-activating-like protein IQGAP1
16	9606.ENSP00000274364	0.809	Ras GTPase-activating-like protein IQGAP2
17	9606.ENSP00000356379	0.784	Abnormal spindle-like microcephaly-associated protein
18	9606.ENSP00000362146	0.772	Borealin
19	9606.ENSP00000260731	0.771	Kinesin-like protein KIF11
20	9606.ENSP00000287598	0.766	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.998	enzyme binding
GO:0008092	0.955	cytoskeletal protein binding
GO:0051020	0.906	GTPase binding
GO:0031267	0.893	small GTPase binding
GO:0005516	0.883	calmodulin binding
GO:0017022	0.570	myosin binding
GO:0032027	0.563	myosin light chain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009966	0.943	regulation of signal transduction
GO:0048522	0.935	positive regulation of cellular process
GO:0051716	0.934	cellular response to stimulus
GO:0051173	0.931	positive regulation of nitrogen compound metabolic process
GO:0010604	0.927	positive regulation of macromolecule metabolic process
GO:0007165	0.918	signal transduction
GO:0032502	0.915	developmental process
GO:0048856	0.909	anatomical structure development
GO:0031325	0.898	positive regulation of cellular metabolic process
GO:0080090	0.892	regulation of primary metabolic process
GO:1902531	0.860	regulation of intracellular signal transduction
GO:0071704	0.856	organic substance metabolic process
GO:1903047	0.848	mitotic cell cycle process
GO:0044238	0.839	primary metabolic process
GO:0048584	0.834	positive regulation of response to stimulus
GO:0044772	0.829	mitotic cell cycle phase transition
GO:0044237	0.806	cellular metabolic process
GO:0019220	0.806	regulation of phosphate metabolic process
GO:0031399	0.784	regulation of protein modification process
GO:0051247	0.780	positive regulation of protein metabolic process
GO:0000082	0.769	G1/S transition of mitotic cell cycle
GO:0001932	0.762	regulation of protein phosphorylation
GO:0071840	0.757	cellular component organization or biogenesis
GO:0031401	0.754	positive regulation of protein modification process
GO:0006807	0.744	nitrogen compound metabolic process
GO:0009888	0.725	tissue development
GO:0016043	0.715	cellular component organization
GO:0035556	0.705	intracellular signal transduction
GO:0007264	0.686	small GTPase mediated signal transduction
GO:0043408	0.682	regulation of MAPK cascade
GO:0010562	0.678	positive regulation of phosphorus metabolic process
GO:0043170	0.659	macromolecule metabolic process
GO:0007265	0.652	Ras protein signal transduction
GO:0010647	0.647	positive regulation of cell communication
GO:1901564	0.644	organonitrogen compound metabolic process
GO:0070371	0.637	ERK1 and ERK2 cascade
GO:0045937	0.626	positive regulation of phosphate metabolic process
GO:0023056	0.619	positive regulation of signaling
GO:0042327	0.617	positive regulation of phosphorylation
GO:0019538	0.614	protein metabolic process
GO:0061180	0.608	mammary gland epithelium development
GO:0050673	0.532	epithelial cell proliferation
GO:0050678	0.523	regulation of epithelial cell proliferation
GO:0016310	0.505	phosphorylation
GO:0008284	0.494	positive regulation of cell population proliferation
GO:0050679	0.466	positive regulation of epithelial cell proliferation
GO:0036211	0.449	protein modification process
GO:0001934	0.436	positive regulation of protein phosphorylation
GO:0050793	0.419	regulation of developmental process
GO:0048519	0.404	negative regulation of biological process
GO:0009967	0.393	positive regulation of signal transduction
GO:0032501	0.337	multicellular organismal process
GO:0043410	0.331	positive regulation of MAPK cascade
GO:0051094	0.305	positive regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0030054	0.993	cell junction
GO:0070161	0.981	anchoring junction
GO:0005829	0.976	cytosol
GO:0043227	0.901	membrane-bounded organelle
GO:0043229	0.889	intracellular organelle
GO:0043231	0.848	intracellular membrane-bounded organelle
GO:0016328	0.830	lateral plasma membrane
GO:0043232	0.713	intracellular non-membrane-bounded organelle
GO:0005911	0.711	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]