StarFunc result for job id Q86VI4

User Input

>input (317 residues)
MTSRTRVTWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERR
RSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLG
VWYLIINAVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMA
TYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPNFPYRDDVMSV
NPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDD
ATVNGAAKEPPPPYVSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VI4	1.000	1.000	7.285E-45	317	1.000	1.000	Q86VI4.pdb.gz	LAP4B_HUMAN Lysosomal-associated transmembrane protein 4B OS=Homo sapiens OX=9606 GN=LAPTM4B PE=1 SV=2
2	AFDB:Q15012	0.502	0.663	7.083E-15	233	0.315	0.429	Q15012.pdb.gz	LAP4A_HUMAN Lysosomal-associated transmembrane protein 4A OS=Homo sapiens OX=9606 GN=LAPTM4A PE=1 SV=1
3	AFDB:O02051	0.407	0.590	1.373E-2	202	0.082	0.129	O02051.pdb.gz	CUTI_CAEEL Protein cuti-1 OS=Caenorhabditis elegans OX=6239 GN=cuti-1 PE=1 SV=2
4	AFDB:A0A0B4LF79	0.172	0.065	2.255E-2	1000	0.123	0.039	A0A0B4LF79.pdb.gz	A0A0B4LF79_DROME Stac-like, isoform Q OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
5	PDB:6k4jA	0.363	0.490	3.298E-2	220	0.101	0.145	6k4jA.pdb.gz
6	AFDB:A0A0B4LFI1	0.168	0.061	3.318E-2	1089	0.126	0.037	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
7	AFDB:A0A0B4LGK0	0.163	0.052	4.136E-2	1198	0.123	0.033	A0A0B4LGK0.pdb.gz	A0A0B4LGK0_DROME Stac-like, isoform V OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
8	AFDB:Q9D956	0.258	0.231	4.371E-2	376	0.123	0.104	Q9D956.pdb.gz	MALD3_MOUSE MARVEL domain-containing protein 3 OS=Mus musculus OX=10090 GN=Marveld3 PE=2 SV=1
9	AFDB:P20490	0.277	0.346	5.450E-2	235	0.104	0.140	P20490.pdb.gz	FCERB_MOUSE High affinity immunoglobulin epsilon receptor subunit beta OS=Mus musculus OX=10090 GN=Ms4a2 PE=1 SV=1
10	PDB:6wvgA	0.251	0.186	6.755E-2	443	0.047	0.034	6wvgA.pdb.gz
11	AFDB:Q9DCS1	0.200	0.246	8.018E-2	244	0.098	0.127	Q9DCS1.pdb.gz	T176A_MOUSE Transmembrane protein 176A OS=Mus musculus OX=10090 GN=Tmem176a PE=1 SV=2
12	AFDB:P13386	0.287	0.352	1.554E-1	243	0.123	0.160	P13386.pdb.gz	FCERB_RAT High affinity immunoglobulin epsilon receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Ms4a2 PE=1 SV=1
13	PDB:7u9tA	0.159	0.015	1.823E-1	4229	0.082	0.006	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
14	PDB:7p5jA	0.147	0.121	6.848E-1	399	0.085	0.068	7p5jA.pdb.gz
15	PDB:7p5cA	0.157	0.128	8.539E-1	392	0.091	0.074	7p5cA.pdb.gz
16	PDB:6c9aB	0.140	0.075	1.403	723	0.085	0.037	6c9aB.pdb.gz	Structural insights into the voltage and phospholipid activation of the mammalian TPC1 channel.
17	PDB:4k34A	0.168	0.144	1.848	381	0.069	0.058	4k34A.pdb.gz
18	PDB:6uw9A	0.116	0.080	1.848	582	0.066	0.036	6uw9A.pdb.gz
19	PDB:7zw1A	0.235	0.235	1.953	317	0.047	0.047	7zw1A.pdb.gz
20	PDB:6jbjA	0.141	0.092	2.181	565	0.060	0.034	6jbjA.pdb.gz	Cryo-EM structure of human lysosomal cobalamin exporter ABCD4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VI4	0.0	650	317	1.000	1.000	LAP4B_HUMAN Lysosomal-associated transmembrane protein 4B OS=Homo sapiens OX=9606 GN=LAPTM4B PE=1 SV=2
2	Q15012	7.02e-59	190	233	0.287	0.391	LAP4A_HUMAN Lysosomal-associated transmembrane protein 4A OS=Homo sapiens OX=9606 GN=LAPTM4A PE=1 SV=1
3	Q60961	1.64e-50	169	233	0.284	0.386	LAP4A_MOUSE Lysosomal-associated transmembrane protein 4A OS=Mus musculus OX=10090 GN=Laptm4a PE=1 SV=1
4	Q13571	2.75e-05	47.0	262	0.189	0.229	LAPM5_HUMAN Lysosomal-associated transmembrane protein 5 OS=Homo sapiens OX=9606 GN=LAPTM5 PE=1 SV=1
5	Q6P9Z7	1.76e-04	44.7	261	0.183	0.222	Q6P9Z7_RAT Lysosomal protein transmembrane 5 OS=Rattus norvegicus OX=10116 GN=Laptm5 PE=3 SV=1
6	Q61168	0.006	40.0	261	0.180	0.218	LAPM5_MOUSE Lysosomal-associated transmembrane protein 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1
7	A0A0G2K184	0.018	38.5	257	0.076	0.093	A0A0G2K184_RAT Lysosomal protein transmembrane 5 OS=Rattus norvegicus OX=10116 GN=Laptm5 PE=3 SV=1
8	Q5XEP9	1.4	33.1	528	0.076	0.045	KCS2_ARATH 3-ketoacyl-CoA synthase 2 OS=Arabidopsis thaliana OX=3702 GN=KCS2 PE=2 SV=2
9	A8WG81	4.6	31.2	339	0.060	0.056	A8WG81_DANRE Transmembrane protein 59-like OS=Danio rerio OX=7955 GN=wu:fi68e12 PE=2 SV=1
10	O95153	5.8	31.2	1857	0.073	0.012	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
11	Q9UGQ3	6.2	31.2	507	0.047	0.030	GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens OX=9606 GN=SLC2A6 PE=1 SV=2
12	Q584E7	6.4	31.2	1467	0.054	0.012	Q584E7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.750 PE=4 SV=1
13	Q4GYE7	6.9	31.2	1638	0.066	0.013	Q4GYE7_TRYB2 PDZ domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4310 PE=4 SV=1
14	F1M9H4	7.3	31.2	2574	0.041	0.005	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03821 Mtp	1.2e-14	66.0	Golgi 4-transmembrane spanning transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402301

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.989	Epidermal growth factor receptor
2	9606.ENSP00000230449	0.911	Exocyst complex component 2
3	9606.ENSP00000424827	0.905	E3 ubiquitin-protein ligase NEDD4
4	9606.ENSP00000294507	0.839	Lysosomal-associated transmembrane protein 5
5	9606.ENSP00000428056	0.825	Phosphatidylinositol 3-kinase regulatory subunit alpha
6	9606.ENSP00000175091	0.819	Lysosomal-associated transmembrane protein 4A
7	9606.ENSP00000367123	0.750	4F2 cell-surface antigen heavy chain
8	9606.ENSP00000261622	0.695	Large neutral amino acids transporter small subunit 1
9	9606.ENSP00000276431	0.660	Tumor necrosis factor receptor superfamily member 10B
10	9606.ENSP00000430548	0.645	Phosphatidylserine synthase 1
11	9606.ENSP00000215531	0.641	Small integral membrane protein 24
12	9606.ENSP00000280734	0.635	Lysoplasmalogenase-like protein TMEM86A
13	9606.ENSP00000371994	0.634	Protein NYNRIN
14	9606.ENSP00000261799	0.626	Platelet-derived growth factor receptor beta
15	9606.ENSP00000361728	0.621	Protein BEX3
16	9606.ENSP00000311083	0.616	Cyclin-dependent kinases regulatory subunit 1
17	9606.ENSP00000379287	0.614	14-3-3 protein zeta/delta
18	9606.ENSP00000250615	0.603	Serotonin N-acetyltransferase
19	9606.ENSP00000380074	0.599	Sodium-coupled neutral amino acid transporter 9
20	9606.ENSP00000272641	0.587	Neurexophilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	1.000	kinase binding
GO:0097001	1.000	ceramide binding
GO:0031625	1.000	ubiquitin protein ligase binding
GO:1902936	1.000	phosphatidylinositol bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.990	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0065008	0.981	regulation of biological quality
GO:0071840	0.975	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0051234	0.973	establishment of localization
GO:0010468	0.966	regulation of gene expression
GO:0006810	0.963	transport
GO:0051641	0.953	cellular localization
GO:0051246	0.939	regulation of protein metabolic process
GO:0051239	0.926	regulation of multicellular organismal process
GO:0048519	0.921	negative regulation of biological process
GO:0006996	0.914	organelle organization
GO:0051128	0.894	regulation of cellular component organization
GO:0016192	0.851	vesicle-mediated transport
GO:0061024	0.819	membrane organization
GO:0010605	0.805	negative regulation of macromolecule metabolic process
GO:0009894	0.795	regulation of catabolic process
GO:0007033	0.755	vacuole organization
GO:0033043	0.749	regulation of organelle organization
GO:0051649	0.745	establishment of localization in cell
GO:0007040	0.743	lysosome organization
GO:0046907	0.719	intracellular transport
GO:0071634	0.713	regulation of transforming growth factor beta production
GO:0010256	0.706	endomembrane system organization
GO:0016050	0.700	vesicle organization
GO:0090559	0.696	regulation of membrane permeability
GO:0016197	0.696	endosomal transport
GO:0071985	0.685	multivesicular body sorting pathway
GO:0044088	0.685	regulation of vacuole organization
GO:0007032	0.649	endosome organization
GO:0032509	0.593	endosome transport via multivesicular body sorting pathway
GO:0051172	0.488	negative regulation of nitrogen compound metabolic process
GO:0051248	0.352	negative regulation of protein metabolic process
GO:0042176	0.335	regulation of protein catabolic process
GO:0048518	0.333	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005768	0.996	endosome
GO:0030659	0.995	cytoplasmic vesicle membrane
GO:0005765	0.995	lysosomal membrane
GO:0031902	0.992	late endosome membrane
GO:0005771	0.962	multivesicular body
GO:0042995	0.957	cell projection
GO:0005769	0.912	early endosome
GO:0032585	0.839	multivesicular body membrane
GO:0097487	0.690	multivesicular body, internal vesicle
GO:0120025	0.425	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]