StarFunc result for job id Q86VK4

User Input

>input (478 residues)
MLSDELESKPELLVQFVQNTSIPLGQGLVESEAKDITCLSLLPVTEASECSRLMLPDDTT
NHSNSSKEVPSSAVLRSLRVNVGPDGEETRAQTVQKSPEFLSTSESSSLLQDLQPSDSTS
FILLNLTRAGLGSSAEHLVFVQDEAEDSGNDFLSSESTDSSIPWFLRVQELAHDSLIAAT
RAQLAKNAKTSSNGENVHLGSGDGQSKDSGPLPQVEKKLKCTVEGCDRTFVWPAHFKYHL
KTHRNDRSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMCHESGCGKQFTTAGNLKNHR
RIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVHSGEKPHQCQVCGKTFSQSGSRNVHMRK
HHLQLGAAGSQEQEQTAEPLMGSSLLEEASVPSKNLVSMNSQPSLGGESLNLPNTNSILG
VDDEVLAEGSPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VK4	1.000	1.000	1.303E-82	478	1.000	1.000	Q86VK4.pdb.gz	ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens OX=9606 GN=ZNF410 PE=1 SV=2
2	AFDB:P36508	0.284	0.240	5.749E-19	570	0.253	0.212	P36508.pdb.gz	ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens OX=9606 GN=ZNF76 PE=1 SV=2
3	AFDB:O70230	0.290	0.219	5.900E-17	638	0.245	0.183	O70230.pdb.gz	ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus OX=10090 GN=Znf143 PE=1 SV=2
4	AFDB:Q1LYE3	0.225	0.174	7.083E-17	623	0.268	0.205	Q1LYE3.pdb.gz	ZN143_DANRE Zinc finger protein 143 OS=Danio rerio OX=7955 GN=znf143 PE=2 SV=2
5	AFDB:A0A2R8QHY4	0.179	0.118	3.137E-14	774	0.232	0.143	A0A2R8QHY4.pdb.gz
6	AFDB:P08155	0.184	0.111	6.133E-14	845	0.234	0.133	P08155.pdb.gz	KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster OX=7227 GN=Kr-h1 PE=2 SV=2
7	AFDB:O57311	0.248	0.268	7.826E-14	441	0.236	0.256	O57311.pdb.gz	ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis OX=8355 GN=zic3 PE=2 SV=3
8	AFDB:Q9H116	0.154	0.107	1.354E-13	711	0.197	0.132	Q9H116.pdb.gz	GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens OX=9606 GN=GZF1 PE=1 SV=1
9	AFDB:Q5DTH6	0.265	0.197	2.343E-13	653	0.182	0.133	Q5DTH6.pdb.gz	Q5DTH6_MOUSE MKIAA4205 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp386 PE=2 SV=1
10	AFDB:A0A024R4Z1	0.167	0.143	2.647E-13	570	0.195	0.163	A0A024R4Z1.pdb.gz
11	PDB:3w5kB	0.093	0.243	2.654E-4	110	0.094	0.409	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7vdvV	0.079	0.132	1.673E-2	238	0.075	0.151	7vdvV.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
13	PDB:6t9iB	0.067	0.119	4.493E-1	224	0.044	0.094	6t9iB.pdb.gz
14	PDB:8apaM1	0.071	0.118	6.883E-1	234	0.042	0.085	8apaM1.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
15	PDB:3dbhI	0.061	0.222	1.054	86	0.023	0.128	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
16	PDB:1a5rA	0.049	0.150	1.121	103	0.021	0.097	1a5rA.pdb.gz
17	PDB:5n9jE	0.064	0.135	1.191	201	0.061	0.144	5n9jE.pdb.gz
18	PDB:6aa3A	0.079	0.166	1.266	162	0.033	0.099	6aa3A.pdb.gz	Discovery of a new class of MTH1 inhibitor by X-ray crystallographic screening.
19	PDB:7l08AF	0.062	0.097	1.266	208	0.054	0.125	7l08AF.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
20	PDB:8dnuA	0.050	0.063	1.266	370	0.008	0.011	8dnuA.pdb.gz	A cryo-electron microscopic approach to elucidate protein structures from human brain microsomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VK4	0.0	979	478	1.000	1.000	ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens OX=9606 GN=ZNF410 PE=1 SV=2
2	P36508	2.11e-47	174	570	0.180	0.151	ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens OX=9606 GN=ZNF76 PE=1 SV=2
3	Q8BMU0	5.08e-47	173	568	0.188	0.158	ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus OX=10090 GN=Znf76 PE=2 SV=1
4	O70230	9.11e-46	171	638	0.172	0.129	ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus OX=10090 GN=Znf143 PE=1 SV=2
5	Q5XIU2	9.86e-46	171	638	0.172	0.129	ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus OX=10116 GN=Znf143 PE=2 SV=2
6	P52747	3.22e-45	169	638	0.172	0.129	ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143 PE=1 SV=2
7	Q1LYE3	3.22e-41	157	623	0.157	0.120	ZN143_DANRE Zinc finger protein 143 OS=Danio rerio OX=7955 GN=znf143 PE=2 SV=2
8	Q07243	1.03e-38	151	675	0.144	0.102	MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus OX=10090 GN=Mtf1 PE=1 SV=2
9	D3ZBT4	1.13e-38	151	675	0.144	0.102	D3ZBT4_RAT Metal-regulatory transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Mtf1 PE=1 SV=1
10	Q14872	4.23e-38	150	753	0.142	0.090	MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens OX=9606 GN=MTF1 PE=1 SV=2
11	Q8QGH4	1.83e-37	147	593	0.140	0.113	Q8QGH4_DANRE Metal regulatory transcription factor 1 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
12	A0A0B5H7U7	2.60e-37	147	722	0.140	0.093	A0A0B5H7U7_DANRE Metal regulatory transcription factor 1 isoform X2 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
13	A0A0G2KFP7	2.64e-37	147	749	0.140	0.089	A0A0G2KFP7_DANRE Metal regulatory transcription factor 1 isoform X1 OS=Danio rerio OX=7955 GN=MTF-1 PE=4 SV=2
14	P13360	6.97e-32	130	604	0.128	0.101	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
15	Q60821	7.82e-32	131	794	0.132	0.079	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
16	Q13105	1.32e-31	130	803	0.138	0.082	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
17	X2JCQ6	1.16e-30	128	822	0.136	0.079	X2JCQ6_DROME Metal response element-binding transcription Factor-1, isoform F OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
18	Q4VBD9	2.20e-30	127	706	0.136	0.092	GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus OX=10090 GN=Gzf1 PE=1 SV=2
19	Q8IYX0	2.77e-30	124	411	0.130	0.151	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
20	Q8BGV5	2.93e-30	125	572	0.136	0.114	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	1.2e-17	74.4	Zinc finger, C2H2 type
2	PF16622 zf-C2H2_11	1.4	20.0	zinc-finger C2H2-type
3	PF13894 zf-C2H2_4	2.3e-08	45.2	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	2.6	19.8	C2H2-type zinc ribbon
5	PF17017 zf-C2H2_aberr	0.88	21.2	Aberrant zinc-finger
6	PF12171 zf-C2H2_jaz	1.3e+02	14.2	Zinc-finger double-stranded RNA-binding
7	PF13913 zf-C2HC_2	0.75	21.0	zinc-finger of a C2HC-type
8	PF13465 zf-H2C2_2	7.5e-18	75.3	Zinc-finger double domain
9	PF12874 zf-met	4.7e+02	12.6	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000011073

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000008451	0.738	Transcription factor CP2
2	9598.ENSPTRP00000020014	0.702	Integrin beta 1 binding protein 1
3	9598.ENSPTRP00000031848	0.699	Uncharacterized protein
4	9598.ENSPTRP00000007342	0.695	Mannosyltransferase
5	9598.ENSPTRP00000031849	0.685	Uncharacterized protein
6	9598.ENSPTRP00000044806	0.667	CLOCK-interacting pacemaker
7	9598.ENSPTRP00000021253	0.657	Transcription factor CP2-like 1
8	9598.ENSPTRP00000034212	0.602	Methionine sulfoxide reductase A
9	9598.ENSPTRP00000020009	0.589	Uncharacterized protein
10	9598.ENSPTRP00000022090	0.574	Ring finger protein 25
11	9598.ENSPTRP00000025410	0.552	Uncharacterized protein
12	9598.ENSPTRP00000006596	0.526	Uncharacterized protein
13	9598.ENSPTRP00000020042	0.504	Pan troglodytes E2F transcription factor 6 (E2F6), mRNA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.888	transcription regulator activity
GO:0003700	0.704	DNA-binding transcription factor activity
GO:0000981	0.671	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0080090	0.986	regulation of primary metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0010605	0.965	negative regulation of macromolecule metabolic process
GO:0045893	0.800	positive regulation of DNA-templated transcription
GO:0010629	0.752	negative regulation of gene expression
GO:0006357	0.742	regulation of transcription by RNA polymerase II
GO:0045944	0.697	positive regulation of transcription by RNA polymerase II
GO:0009987	0.650	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.971	cytoplasm
GO:0005829	0.552	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]