StarFunc result for job id Q86VM9

User Input

>input (953 residues)
MDVAESPERDPHSPEDEEQPQGLSDDDILRDSGSDQDLDGAGVRASDLEDEESAARGPSQ
EEEDNHSDEEDRASEPKSQDQDSEVNELSRGPTSSPCEEEGDEGEEDRTSDLRDEASSVT
RELDEHELDYDEEVPEEPAPAVQEDEAEKAGAEDDEEKGEGTPREEGKAGVQSVGEKESL
EAAKEKKKEDDDGEIDDGEIDDDDLEEGEVKDPSDRKVRPRPTCRFFMKGNCTWGMNCRF
IHPGVNDKGNYSLITKADPFPPNGAPPLGPHPLMPANPWGGPVVDEILPPPPPEPPTESA
WERGLRHAKEVLKKATIRKEQEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVR
DTVLEPYADPYYDYEIERFWRGGQYENFRVQYTETEPYHNYRERERERERENRQRERERE
RERDRERERRQRERERERERERDKERQRRKEEWERERAKRDEKDRQHRDRDREKEREKEK
GKPKPRSPQPPSRQAEPPKKEAATTGPQVKRADEWKDPWRRSKSPKKKLGVSVSPSRARR
RRKTSASSASASNSSRSSSRSSSYSGSGSSRSRSRSSSYSSYSSRSSRHSSFSGSRSRSR
SFSSSPSPSPTPSPHRPSIRTKGEPAPPPGKAGEKSVKKPAPPPAPPQATKTTAPVPEPT
KPGDPREARRKERPARTPPRRRTLSGSGSGSGSSYSGSSSRSRSLSVSSVSSVSSATSSS
SSAHSVDSEDMYADLASPVSSASSRSPAPAQTRKEKGKSKKEDGVKEEKRKRDSSTQPPK
SAKPPAGGKSSQQPSTPQQAPPGQPQQGTFVAHKEIKLTLLNKAADKGSRKRYEPSDKDR
QSPPPAKRPNTSPDRGSRDRKSGGRLGSPKPERQRGQNSKAPAAPADRKRQLSPQSKSSS
KVTSVPGKASDPGAASTKSGKASTLSRREELLKQLKAVEDAIARKRAKIPGKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7ERS3	0.114	0.111	0.000	977	1.000	0.975	E7ERS3.pdb.gz	E7ERS3_HUMAN Zinc finger CCCH-type containing 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=1
2	AFDB:Q86VM9	0.999	0.999	0.000	953	1.000	1.000	Q86VM9.pdb.gz	ZCH18_HUMAN Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2
3	AFDB:Q8MYV4	0.059	0.056	4.658E-7	1000	0.233	0.222	Q8MYV4.pdb.gz	Q8MYV4_DROME RH35718p OS=Drosophila melanogaster OX=7227 GN=CG1677 PE=2 SV=1
4	AFDB:A0A1D8PD52	0.044	0.037	6.713E-4	1287	0.143	0.106	A0A1D8PD52.pdb.gz	A0A1D8PD52_CANAL Msb1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB1 PE=4 SV=1
5	AFDB:Q8NAP3	0.038	0.033	1.586E-3	1195	0.153	0.122	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
6	AFDB:A0A0B4K620	0.042	0.033	2.207E-3	1344	0.155	0.110	A0A0B4K620.pdb.gz	A0A0B4K620_DROME Mustard, isoform V OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
7	AFDB:A1ZAU8	0.055	0.042	2.875E-3	1630	0.154	0.090	A1ZAU8.pdb.gz	PTRO_DROME Patronin OS=Drosophila melanogaster OX=7227 GN=Patronin PE=1 SV=1
8	AFDB:Q9GRZ3	0.073	0.048	5.950E-3	1641	0.149	0.087	Q9GRZ3.pdb.gz	DPY21_CAEEL Lysine-specific demethylase 9 OS=Caenorhabditis elegans OX=6239 GN=dpy-21 PE=1 SV=1
9	AFDB:Q8NB66	0.060	0.035	6.791E-3	2214	0.151	0.065	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
10	AFDB:Q09472	0.038	0.025	1.153E-2	2414	0.136	0.054	Q09472.pdb.gz	EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2
11	PDB:6zqaUB	0.037	0.061	1.762	504	0.020	0.038	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
12	PDB:7d5sRN	0.033	0.047	2.799	607	0.022	0.035	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:5gm6P	0.040	0.115	5.075	246	0.031	0.122	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7mqaNB	0.035	0.172	6.188	103	0.019	0.175	7mqaNB.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7r5jV0	0.037	0.092	6.188	273	0.020	0.070	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:2m0qA	0.037	0.195	6.611	123	0.013	0.098	2m0qA.pdb.gz
17	PDB:5xtcU	0.032	0.210	8.061	83	0.009	0.108	5xtcU.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
18	PDB:6hivCv	0.036	0.033	8.612	1059	0.017	0.015	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:5dgeSM	0.032	0.137	9.201	159	0.013	0.075	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
20	PDB:6ahd1	0.034	0.031	9.201	1048	0.015	0.013	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ERS3	0.0	1850	977	1.000	0.975	E7ERS3_HUMAN Zinc finger CCCH-type containing 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=1
2	Q86VM9	0.0	1864	953	1.000	1.000	ZCH18_HUMAN Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2
3	H3BRH3	2.46e-123	374	196	0.206	1.000	H3BRH3_HUMAN Zinc finger CCCH-type containing 18 (Fragment) OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=1
4	Q8MYV4	2.24e-25	115	1000	0.066	0.063	Q8MYV4_DROME RH35718p OS=Drosophila melanogaster OX=7227 GN=CG1677 PE=2 SV=1
5	Q9W3R9	2.31e-25	115	1000	0.066	0.063	Q9W3R9_DROME FI03239p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1677 PE=1 SV=2
6	X2JE07	2.41e-25	115	999	0.066	0.063	X2JE07_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1677 PE=1 SV=1
7	Q8IDX6	5.53e-05	49.7	3130	0.037	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
8	F1QBY1	1.78e-04	48.1	2876	0.036	0.012	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
9	F4JQG2	6.36e-04	45.8	551	0.030	0.053	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
10	Q12019	0.002	44.7	4910	0.055	0.011	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
11	C0H5F4	0.003	44.3	3254	0.027	0.008	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
12	Q9LFE0	0.011	42.0	820	0.040	0.046	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
13	Q70HU3	0.073	39.7	1135	0.010	0.009	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
14	Q7KU01	0.073	39.7	1135	0.010	0.009	Q7KU01_DROME Phosphatase 1 nuclear targeting subunit, isoform D OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=1 SV=1
15	Q5T200	0.22	38.1	1668	0.020	0.011	ZC3HD_HUMAN Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13 PE=1 SV=1
16	Q8TDR0	0.28	37.4	691	0.082	0.113	MIPT3_HUMAN TRAF3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TRAF3IP1 PE=1 SV=1
17	Q6PGZ3	0.33	37.4	629	0.029	0.045	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
18	Q96AG4	0.38	36.6	307	0.039	0.121	LRC59_HUMAN Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1
19	B6EUA9	0.43	37.0	958	0.035	0.034	PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana OX=3702 GN=PRP40A PE=1 SV=1
20	F1RAH8	0.47	36.6	450	0.042	0.089	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16131 Torus	19	17.4	Torus domain
2	PF00642 zf-CCCH	0.74	21.1	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
3	PF14608 zf-CCCH_2	37	16.3	RNA-binding, Nab2-type zinc finger
4	PF18044 zf-CCCH_4	3.2e-06	38.0	CCCH-type zinc finger
5	PF18345 zf_CCCH_4	0.052	24.8	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416951

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326806	0.870	Nuclear cap-binding protein subunit 2
2	9606.ENSP00000301740	0.837	Serine/arginine repetitive matrix protein 2
3	9606.ENSP00000216832	0.813	Pinin
4	9606.ENSP00000480421	0.812	Serrate RNA effector molecule homolog
5	9606.ENSP00000364289	0.807	Nuclear cap-binding protein subunit 1
6	9606.ENSP00000374280	0.803	RNA polymerase-associated protein RTF1 homolog
7	9606.ENSP00000364639	0.798	RNA-binding protein 7
8	9606.ENSP00000312981	0.775	U4/U6.U5 tri-snRNP-associated protein 2
9	9606.ENSP00000438993	0.772	Zinc finger CCHC domain-containing protein 8
10	9606.ENSP00000299601	0.760	RNA polymerase-associated protein LEO1
11	9606.ENSP00000262710	0.759	Apoptotic chromatin condensation inducer in the nucleus
12	9606.ENSP00000221494	0.754	Splicing factor 3A subunit 2
13	9606.ENSP00000264313	0.750	SLAIN motif-containing protein 2
14	9606.ENSP00000457723	0.747	RNA-binding protein with serine-rich domain 1
15	9606.ENSP00000278412	0.733	FACT complex subunit SSRP1
16	9606.ENSP00000263377	0.715	Bromodomain-containing protein 4
17	9606.ENSP00000261973	0.700	RNA-binding protein 25
18	9606.ENSP00000359645	0.689	RNA-binding motif protein, X chromosome
19	9606.ENSP00000457411	0.689	Ubiquitin carboxyl-terminal hydrolase 10
20	9606.ENSP00000357679	0.678	Chromatin target of PRMT1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0140262	0.994	mRNA cap binding complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0031325	0.978	positive regulation of cellular metabolic process
GO:0010604	0.974	positive regulation of macromolecule metabolic process
GO:0010468	0.969	regulation of gene expression
GO:0051173	0.961	positive regulation of nitrogen compound metabolic process
GO:0031329	0.959	regulation of cellular catabolic process
GO:0051252	0.958	regulation of RNA metabolic process
GO:0010608	0.922	post-transcriptional regulation of gene expression
GO:0065008	0.903	regulation of biological quality
GO:0043487	0.838	regulation of RNA stability
GO:0045935	0.827	positive regulation of nucleobase-containing compound metabolic process
GO:0009896	0.802	positive regulation of catabolic process
GO:0031331	0.768	positive regulation of cellular catabolic process
GO:0051254	0.726	positive regulation of RNA metabolic process
GO:0009987	0.716	cellular process
GO:0071704	0.707	organic substance metabolic process
GO:0044237	0.689	cellular metabolic process
GO:0044238	0.682	primary metabolic process
GO:0006807	0.665	nitrogen compound metabolic process
GO:0043170	0.656	macromolecule metabolic process
GO:0034641	0.611	cellular nitrogen compound metabolic process
GO:1901360	0.585	organic cyclic compound metabolic process
GO:0090304	0.574	nucleic acid metabolic process
GO:0010467	0.497	gene expression
GO:0016070	0.406	RNA metabolic process
GO:0050779	0.370	RNA destabilization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	1.000	nuclear speck
GO:0032991	0.994	protein-containing complex
GO:1990904	0.953	ribonucleoprotein complex
GO:0005737	0.544	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]