StarFunc result for job id Q86VP6

User Input

>input (1230 residues)
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDK
NGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPA
SSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCL
LPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAA
ISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINI
CLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAV
VSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQ
GETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGI
IFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEAL
LVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNL
GDNLGSDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLR
KNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLA
KVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLT
GPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALL
SLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEIT
SQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTL
IDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDL
NVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLD
IRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQ
RLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQS
QISSNPELAAIFESIQKDSSSTNLESMDTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97536	0.923	0.923	0.000	1230	0.997	0.997	P97536.pdb.gz	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
2	PDB:4a0cA	0.734	0.778	9.927E-99	1155	0.933	0.994	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
3	AFDB:O75155	0.907	0.903	7.456E-94	1236	0.625	0.622	O75155.pdb.gz	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
4	AFDB:Q9VKY2	0.951	0.938	1.634E-91	1248	0.594	0.586	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
5	AFDB:Q9R0L4	0.880	0.852	2.841E-91	1273	0.603	0.583	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
6	AFDB:Q8L5Y6	0.943	0.951	2.787E-73	1219	0.428	0.432	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
7	AFDB:A0A0C4DGH5	0.437	0.672	9.365E-70	770	0.621	0.992	A0A0C4DGH5.pdb.gz	A0A0C4DGH5_HUMAN Cullin associated and neddylation dissociated 1 (Fragment) OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=1
8	AFDB:G5ED41	0.895	0.866	8.982E-65	1274	0.379	0.366	G5ED41.pdb.gz	CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans OX=6239 GN=cand-1 PE=1 SV=1
9	AFDB:Q5BAH2	0.640	0.746	4.664E-37	1041	0.240	0.283	Q5BAH2.pdb.gz	CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=candA-C PE=1 SV=1
10	AFDB:Q9P3A8	0.747	0.752	9.541E-35	1220	0.198	0.199	Q9P3A8.pdb.gz	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
11	AFDB:Q387F9	0.683	0.688	3.877E-24	1220	0.174	0.175	Q387F9.pdb.gz	Q387F9_TRYB2 TATA-binding protein interacting (TIP20) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0210 PE=3 SV=1
12	PDB:6xu2A	0.322	0.355	1.456E-14	1091	0.121	0.137	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:7unkA	0.267	0.301	2.476E-13	1047	0.145	0.170	7unkA.pdb.gz
14	PDB:4jlqA	0.290	0.394	4.612E-13	840	0.119	0.174	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	PDB:3w3uA	0.255	0.292	7.480E-13	1030	0.123	0.147	3w3uA.pdb.gz
16	PDB:6bcuA	0.195	0.119	1.094E-12	2204	0.129	0.072	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
17	PDB:3w3zA	0.395	0.459	3.084E-12	1013	0.120	0.146	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
18	PDB:6tc0C	0.201	0.234	4.833E-12	994	0.120	0.149	6tc0C.pdb.gz
19	PDB:6ahd1	0.344	0.394	5.745E-12	1048	0.093	0.110	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
20	PDB:3nd2A	0.257	0.341	6.156E-12	861	0.104	0.149	3nd2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGH5	0.0	1222	770	0.496	0.792	A0A0C4DGH5_HUMAN Cullin associated and neddylation dissociated 1 (Fragment) OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=1
2	G5ED41	0.0	742	1274	0.383	0.370	CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans OX=6239 GN=cand-1 PE=1 SV=1
3	O75155	0.0	1513	1236	0.630	0.627	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
4	P97536	0.0	2509	1230	0.998	0.998	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
5	Q6ZQ38	0.0	2503	1230	0.994	0.994	CAND1_MOUSE Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus OX=10090 GN=Cand1 PE=1 SV=2
6	Q6ZQ73	0.0	1497	1235	0.608	0.606	CAND2_MOUSE Cullin-associated NEDD8-dissociated protein 2 OS=Mus musculus OX=10090 GN=Cand2 PE=1 SV=2
7	Q86VP6	0.0	2516	1230	1.000	1.000	CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2
8	Q8L5Y6	0.0	944	1219	0.433	0.436	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
9	Q9R0L4	0.0	1460	1273	0.607	0.586	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
10	Q9VKY2	0.0	1417	1248	0.599	0.591	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
11	Q5BAH2	2.22e-111	376	1041	0.259	0.305	CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=candA-C PE=1 SV=1
12	Q9P3A8	1.20e-24	114	1220	0.090	0.091	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
13	C8VP82	6.19e-13	73.9	339	0.062	0.224	CAN1N_EMENI Cullin-associated NEDD8-dissociated protein 1, N-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=candA-N PE=1 SV=1
14	Q387F9	1.02e-05	52.4	1220	0.049	0.049	Q387F9_TRYB2 TATA-binding protein interacting (TIP20) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0210 PE=3 SV=1
15	F4I893	0.011	42.7	2696	0.029	0.013	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
16	P87145	0.033	40.8	811	0.020	0.031	VAC14_SCHPO Protein VAC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC25H2.03 PE=3 SV=1
17	Q93VS8	0.086	39.7	1116	0.056	0.062	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
18	P33892	0.13	39.3	2672	0.027	0.012	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
19	Q92616	0.20	38.5	2671	0.033	0.015	GCN1_HUMAN Stalled ribosome sensor GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=7
20	E9PVA8	0.22	38.5	2671	0.033	0.015	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	0.00011	32.7	Adaptin N terminal region
2	PF05918 API5	5.1	17.5	Apoptosis inhibitory protein 5 (API5)
3	PF12348 CLASP_N	8.5e-05	33.8	CLASP N terminal
4	PF12717 Cnd1	8.5e-05	34.1	non-SMC mitotic condensation complex subunit 1
5	PF07539 DRIM	0.4	20.5	Down-regulated in metastasis
6	PF09324 DUF1981	17	16.7	Domain of unknown function (DUF1981)
7	PF11865 DUF3385	0.11	23.9	Domain of unknown function (DUF3385)
8	PF20416 DUF6700	2.1e+02	12.8	Domain of unknown function (DUF6700)
9	PF02985 HEAT	3e-14	62.9	HEAT repeat
10	PF13646 HEAT_2	2.6e-21	87.1	HEAT repeats
11	PF13513 HEAT_EZ	2.9e-16	70.9	HEAT-like repeat
12	PF12460 MMS19_C	3.7e-13	60.9	RNAPII transcription regulator C-terminal
13	PF08161 NUC173	27	15.9	NUC173 domain
14	PF08167 RIX1	0.23	22.7	rRNA processing/ribosome biogenesis
15	PF05327 RRN3	2.9e+02	11.4	RNA polymerase I specific transcription initiation factor RRN3
16	PF10363 RTP1_C1	0.0026	29.3	Required for nuclear transport of RNA pol II C-terminus 1
17	PF10193 Telomere_reg-2	5.8e-05	34.8	Telomere length regulation protein
18	PF08623 TIP120	6.5e-64	226.2	TATA-binding protein interacting (TIP20)
19	PF10521 Tti2	7.7	17.6	Tti2 family
20	PF08064 UME	1.8e-09	48.8	UME (NUC010) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007463638.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007469928.1	0.998	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
2	118797.XP_007464486.1	0.989	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
3	118797.XP_007454163.1	0.987	Ring-box 1
4	118797.XP_007471401.1	0.977	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
5	118797.XP_007446102.1	0.971	RAB28, member RAS oncogene family
6	118797.XP_007450105.1	0.967	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
7	118797.XP_007466424.1	0.961	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
8	118797.XP_007447274.1	0.929	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
9	118797.XP_007468985.1	0.905	Defective in cullin neddylation 1 domain containing 1
10	118797.XP_007447023.1	0.875	RING-box protein 2 isoform X1
11	118797.XP_007469645.1	0.870	CDK2-associated and cullin domain-containing protein 1
12	118797.XP_007462246.1	0.859	DNA damage-binding protein 1
13	118797.XP_007447863.1	0.789	Belongs to the SKP1 family.
14	118797.XP_007472287.1	0.789	Belongs to the SKP1 family.
15	118797.XP_007457550.1	0.736	Belongs to the ubiquitin-conjugating enzyme family.
16	118797.XP_007453771.1	0.726	Transcription elongation factor B polypeptide 1
17	118797.XP_007451374.1	0.725	Denticleless protein homolog isoform X1
18	118797.XP_007459753.1	0.714	DDB1- and CUL4-associated factor 4 isoform X1
19	118797.XP_007448551.1	0.693	COP9 signalosome complex subunit 5
20	118797.XP_007447949.1	0.684	Neural precursor cell expressed, developmentally down-regulated 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017025	0.856	TBP-class protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050789	0.934	regulation of biological process
GO:0009987	0.865	cellular process
GO:0071704	0.842	organic substance metabolic process
GO:0044238	0.838	primary metabolic process
GO:0050794	0.830	regulation of cellular process
GO:0006807	0.826	nitrogen compound metabolic process
GO:0043170	0.802	macromolecule metabolic process
GO:1901564	0.789	organonitrogen compound metabolic process
GO:0019538	0.752	protein metabolic process
GO:0019222	0.710	regulation of metabolic process
GO:0051171	0.691	regulation of nitrogen compound metabolic process
GO:0060255	0.679	regulation of macromolecule metabolic process
GO:0080090	0.672	regulation of primary metabolic process
GO:0036211	0.637	protein modification process
GO:0070647	0.509	protein modification by small protein conjugation or removal
GO:0032446	0.493	protein modification by small protein conjugation
GO:0048518	0.485	positive regulation of biological process
GO:0009893	0.448	positive regulation of metabolic process
GO:0010604	0.440	positive regulation of macromolecule metabolic process
GO:0048522	0.431	positive regulation of cellular process
GO:0016567	0.396	protein ubiquitination
GO:0051173	0.388	positive regulation of nitrogen compound metabolic process
GO:0071840	0.381	cellular component organization or biogenesis
GO:0044237	0.355	cellular metabolic process
GO:0031323	0.348	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005829	0.976	cytosol
GO:0031981	0.975	nuclear lumen
GO:0005654	0.972	nucleoplasm
GO:0032991	0.931	protein-containing complex
GO:0140535	0.682	intracellular protein-containing complex
GO:1902494	0.620	catalytic complex
GO:0012505	0.591	endomembrane system
GO:0000151	0.557	ubiquitin ligase complex
GO:0031461	0.506	cullin-RING ubiquitin ligase complex
GO:0016020	0.487	membrane
GO:0005576	0.378	extracellular region
GO:0031982	0.363	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]