StarFunc result for job id Q86VS3

User Input

>input (1027 residues)
MAQNTENHDPVGSILIQIHEDLYQLKEKLTKFSPEEKGETLDIQSLETAIKRTEVGLRIH
IEKYLNVVNQNVLTTSVNDESLYTPQASKWLLPTVIDQKSFIFPQESEGTFWQPQRQHSS
SLPVFPRAKIKVSKLIKGSNISSLTVLPSSHCTDPYFTPIPVLQADAHKGILSMIERGLI
PPTARITFQNPPITPRAAPLHSFDEARKIPTVATFTIPREPPPSPAEVKFFPKKQRSKGK
SRRSRGHHDRKAMKVKTPLRALKSLWDYDFLIYDGVIDNTAPDFLAFKEHFSLAWGGIFS
LLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPAHVQMLINLPG
QRYKGQDGNSEAAMKIQATWKCYKARKFFLFYRQQKWASGVIAIAWLLYCHKTRLKKILK
ESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGYSQPVREHIADFNTQQNMQLGR
LCDILDANVNVIYICSHHMNDELVLYYKKILSLHAAVKSGNLEDRSDLQDRFKIITPEAV
NIFPKHHMCLATHLMYSPKAIKRIKNLIRGTEAYIVSGLLHRDDLAVADMLDIPILGSEP
ELAHLYSTKSGGKRVFDSANVAVPPGIYDIYSQQQMIEQLSQLITDHLQIQRWLFKMDSE
FRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQP
VNEKRFPTWRKFLQTFLSQGGVIEAFPPADNVTNLTVDMLIEPNGKISVLSTGDQLHAES
PFISSGTTVPQTSVDPQVLTYLCLQIGKACRMRDVVGYFSIDLVTFIDPSTLEQQVWATG
LNLAYSDQLALTQLTLYLTNGHLDCSLSTLEVPRFVPKERKKTKCMSALSMPMLATSRYA
VMTTQLRHSNLSLVFHYVFLQICRAHGIGYDVEERQGTVFILYEHLKRHKLGMLTIGEDL
QGVLMTFARHLFIIHQEISAPNMQGETNFKTTIADIETILRVTKENKMRFEEEQQSKDDK
NLSKPKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q580S4	0.569	0.668	1.119E-53	859	0.197	0.235	Q580S4.pdb.gz	Q580S4_TRYB2 IQ calmodulin-binding motif family protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.720 PE=4 SV=1
2	PDB:7wtbB	0.267	0.242	3.109E-12	1147	0.065	0.058	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
3	PDB:1dv2A	0.271	0.556	1.043E-11	450	0.066	0.151	1dv2A.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
4	PDB:5douD	0.210	0.157	4.500E-11	1430	0.056	0.040	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
5	PDB:5cskA	0.267	0.149	6.405E-11	1996	0.057	0.030	5cskA.pdb.gz
6	PDB:6g2dC	0.252	0.134	2.907E-10	2121	0.055	0.026	6g2dC.pdb.gz
7	PDB:5cslB	0.260	0.140	3.215E-10	2072	0.053	0.026	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
8	PDB:3bg5A	0.249	0.228	3.740E-10	1137	0.062	0.056	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
9	PDB:3n6rG	0.234	0.348	5.324E-10	646	0.047	0.074	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
10	PDB:5cslA	0.232	0.127	5.599E-10	2050	0.052	0.026	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
11	PDB:1bxrA	0.241	0.232	5.888E-10	1073	0.045	0.043	1bxrA.pdb.gz	Carbamoyl phosphate synthetase: closure of the B-domain as a result of nucleotide binding.
12	AFDB:E9PSQ0	0.258	0.120	9.588E-9	2460	0.097	0.041	E9PSQ0.pdb.gz	E9PSQ0_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=2
13	AFDB:Q23TC2	0.143	0.162	1.025E-4	875	0.091	0.106	Q23TC2.pdb.gz	TTL3A_TETTS Tubulin glycylase 3A OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTLL3A PE=1 SV=1
14	AFDB:Q5A5R4	0.100	0.089	3.269E-1	1189	0.081	0.070	Q5A5R4.pdb.gz	Q5A5R4_CANAL DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGS1 PE=3 SV=1
15	AFDB:A0A2P1JJM6	0.050	0.086	4.423E-1	519	0.041	0.081	A0A2P1JJM6.pdb.gz	A0A2P1JJM6_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens OX=9606 GN=PLEKHA8 PE=2 SV=1
16	AFDB:A0A0B4K6G5	0.042	0.056	5.145E-1	714	0.088	0.126	A0A0B4K6G5.pdb.gz	A0A0B4K6G5_DROME Na[+]/H[+] hydrogen antiporter 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Nha2 PE=4 SV=1
17	AFDB:Q7JPB9	0.058	0.067	7.702E-1	855	0.094	0.113	Q7JPB9.pdb.gz	Q7JPB9_DROME GH12235p OS=Drosophila melanogaster OX=7227 GN=sei PE=2 SV=1
18	AFDB:A0A087WZY1	0.049	0.147	8.960E-1	265	0.035	0.136	A0A087WZY1.pdb.gz	A0A087WZY1_HUMAN Uncharacterized protein OS=Homo sapiens OX=9606 PE=1 SV=1
19	AFDB:Q9FZD9	0.067	0.095	9.910E-1	695	0.056	0.082	Q9FZD9.pdb.gz	DUF3_ARATH DUF724 domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=DUF3 PE=1 SV=1
20	AFDB:Q9D489	0.036	0.066	1.410	467	0.041	0.090	Q9D489.pdb.gz	SOLH2_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Mus musculus OX=10090 GN=Sohlh2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q580S4	4.84e-63	232	859	0.178	0.213	Q580S4_TRYB2 IQ calmodulin-binding motif family protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.720 PE=4 SV=1
2	G8XHD8	0.66	36.2	482	0.017	0.035	BESA_STREN L-propargylglycine--L-glutamate ligase OS=Streptantibioticus cattleyicolor (strain ATCC 35852 / DSM 46488 / JCM 4925 / NBRC 14057 / NRRL 8057) OX=1003195 GN=besA PE=1 SV=1
3	Q4WVN4	1.2	35.8	8515	0.045	0.005	NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=NRPS8 PE=3 SV=1
4	P39976	3.4	33.9	496	0.017	0.034	DLD3_YEAST D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD3 PE=1 SV=1
5	Q11107	3.4	34.3	2248	0.028	0.013	LIN13_CAEEL Zinc finger protein lin-13 OS=Caenorhabditis elegans OX=6239 GN=lin-13 PE=1 SV=2
6	B7ZLP7	3.9	33.9	593	0.019	0.032	B7ZLP7_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=1
7	A0AV96	4.0	33.9	593	0.019	0.032	RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2
8	Q3UQ44	6.3	33.5	1575	0.030	0.020	IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus OX=10090 GN=Iqgap2 PE=1 SV=2
9	Q9M0A4	8.2	32.7	733	0.019	0.027	CNGC9_ARATH Putative cyclic nucleotide-gated ion channel 9 OS=Arabidopsis thaliana OX=3702 GN=CNGC9 PE=3 SV=1
10	P13368	9.2	32.7	2554	0.017	0.007	7LESS_DROME Protein sevenless OS=Drosophila melanogaster OX=7227 GN=sev PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00612 IQ	11	17.2	IQ calmodulin-binding motif
2	PF18105 PGM1_C	7.5e+02	11.1	PGM1 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445175	0.765	Lactate dehydrogenase A
2	9606.ENSP00000255087	0.560	Tesmin
3	9606.ENSP00000269491	0.545	Serpin B12
4	9606.ENSP00000323670	0.540	Zinc finger and BTB domain-containing protein 7A
5	9606.ENSP00000290431	0.527	Polycystic kidney disease 2-like 2 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.998	catalytic activity
GO:0016874	0.507	ligase activity
GO:0097159	0.346	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0065007	0.797	biological regulation
GO:0008152	0.784	metabolic process
GO:0071704	0.683	organic substance metabolic process
GO:0050789	0.678	regulation of biological process
GO:0022414	0.650	reproductive process
GO:0050794	0.642	regulation of cellular process
GO:0032501	0.536	multicellular organismal process
GO:0044238	0.450	primary metabolic process
GO:0032502	0.416	developmental process
GO:0044237	0.410	cellular metabolic process
GO:0006807	0.375	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005737	0.998	cytoplasm
GO:0043227	0.994	membrane-bounded organelle
GO:0043229	0.980	intracellular organelle
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0005634	0.451	nucleus
GO:0005929	0.361	cilium
GO:0012505	0.358	endomembrane system
GO:0016020	0.343	membrane
GO:0005829	0.331	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	0.507	Ligases.

[back to server]