StarFunc result for job id Q86VV4

User Input

>input (465 residues)
MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEA
AEPECNGFPTKRVRSSSFTFHITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSK
HVIRPAILQLPQARSCAKVRKTFGHKALESCKTKEKTNNKISEGNSYLLSENLSRARISV
QLSTNQDFLGATSVGCQPNEDKCSFKSCSSNFVFGENMVERVLGTQKLTQPQLENDSYAK
EKPFKSIPKFPVNFLSSRTDSIKNTSLIESAAAFSSQPSRKCLLEKIDVITGEETEHNVL
KINCKLFIFNKTTQSWIERGRGTLRLNDTASTDCGTLQSRLIMRNQGSLRLILNSKLWAQ
MKIQRANHKNVRITATDLEDYSIKIFLIQASAQDTAYLYAAIHHRLVALQSFNKQRDVNQ
AESLSETAQQLNCESCDENEDDFIQVTKNGSDPSSWTHRQSVACS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VV4	1.000	1.000	3.345E-67	465	1.000	1.000	Q86VV4.pdb.gz	RNB3L_HUMAN Ran-binding protein 3-like OS=Homo sapiens OX=9606 GN=RANBP3L PE=1 SV=2
2	AFDB:Q6PDH4	0.441	0.420	4.173E-45	491	0.699	0.662	Q6PDH4.pdb.gz	RNB3L_MOUSE Ran-binding protein 3-like OS=Mus musculus OX=10090 GN=Ranbp3l PE=1 SV=1
3	AFDB:Q9H6Z4	0.351	0.293	1.780E-25	567	0.366	0.300	Q9H6Z4.pdb.gz	RANB3_HUMAN Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1
4	AFDB:Q09146	0.271	0.310	1.966E-10	399	0.144	0.168	Q09146.pdb.gz	HBA1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hba1 PE=1 SV=1
5	PDB:3m1iB	0.243	0.796	5.692E-9	131	0.071	0.252	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
6	PDB:1k5dB	0.263	0.785	1.495E-8	146	0.060	0.192	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
7	PDB:1q67B	0.204	0.548	1.319E-4	161	0.037	0.106	1q67B.pdb.gz
8	PDB:6am0F	0.189	0.472	1.963E-4	178	0.037	0.096	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
9	AFDB:Q9ASS2	0.174	0.139	2.568E-4	601	0.131	0.101	Q9ASS2.pdb.gz	FREE1_ARATH Protein FREE1 OS=Arabidopsis thaliana OX=3702 GN=FREE1 PE=1 SV=1
10	AFDB:Q9H254	0.131	0.032	3.306E-3	2564	0.125	0.023	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
11	PDB:6oxlN	0.202	0.626	4.459E-3	124	0.034	0.129	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
12	AFDB:Q8WXE9	0.121	0.074	9.724E-3	905	0.146	0.075	Q8WXE9.pdb.gz	STON2_HUMAN Stonin-2 OS=Homo sapiens OX=9606 GN=STON2 PE=1 SV=1
13	AFDB:P34288	0.154	0.054	1.153E-2	1605	0.142	0.041	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
14	PDB:6xtbE	0.093	0.153	1.239E-2	235	0.030	0.060	6xtbE.pdb.gz
15	PDB:4mt6A	0.172	0.199	1.388E-2	389	0.028	0.033	4mt6A.pdb.gz
16	PDB:3kffA	0.082	0.194	2.186E-2	152	0.015	0.046	3kffA.pdb.gz	High resolution X-ray structures of mouse major urinary protein nasal isoform in complex with pheromones.
17	AFDB:A0A140LH27	0.133	0.041	2.702E-2	1664	0.129	0.036	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
18	PDB:3cm1A	0.167	0.425	3.254E-2	137	0.028	0.095	3cm1A.pdb.gz
19	AFDB:Q550K3	0.101	0.046	4.256E-2	1462	0.120	0.038	Q550K3.pdb.gz	Q550K3_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277075 PE=4 SV=1
20	PDB:7pgrN	0.132	0.033	7.626E-2	2423	0.024	0.005	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PDH4	0.0	616	491	0.714	0.676	RNB3L_MOUSE Ran-binding protein 3-like OS=Mus musculus OX=10090 GN=Ranbp3l PE=1 SV=1
2	Q86VV4	0.0	965	465	1.000	1.000	RNB3L_HUMAN Ran-binding protein 3-like OS=Homo sapiens OX=9606 GN=RANBP3L PE=1 SV=2
3	B7Z7F3	2.62e-72	238	494	0.254	0.239	B7Z7F3_HUMAN RAN binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1
4	Q9H6Z4	8.65e-72	239	567	0.254	0.208	RANB3_HUMAN Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1
5	K7EIJ4	2.12e-52	175	155	0.166	0.497	K7EIJ4_HUMAN RAN binding protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1
6	A0A0B4KGQ0	1.15e-25	111	448	0.151	0.156	A0A0B4KGQ0_DROME Ran binding protein 3, isoform B OS=Drosophila melanogaster OX=7227 GN=RanBP3 PE=1 SV=1
7	Q9VCI7	1.18e-25	111	449	0.151	0.156	Q9VCI7_DROME LD02979p OS=Drosophila melanogaster OX=7227 GN=RanBP3 PE=1 SV=1
8	A0A384ME25	1.38e-19	92.8	397	0.114	0.134	A0A384ME25_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
9	K7ESQ0	2.82e-11	62.8	122	0.090	0.344	K7ESQ0_HUMAN RAN binding protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1
10	Q9USL4	7.47e-11	66.6	549	0.077	0.066	NUP61_SCHPO Nucleoporin nup61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup61 PE=1 SV=2
11	P92985	1.71e-09	60.1	219	0.082	0.174	RBP1C_ARATH Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1
12	P40517	6.29e-09	59.7	327	0.073	0.104	YRB2_YEAST Ran-specific GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB2 PE=1 SV=1
13	Q9LMK7	1.85e-08	57.0	228	0.080	0.162	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
14	Q9C829	2.65e-08	58.2	440	0.062	0.066	NU50A_ARATH Nuclear pore complex protein NUP50A OS=Arabidopsis thaliana OX=3702 GN=NUP50A PE=1 SV=1
15	Q9LW88	3.53e-08	57.8	465	0.058	0.058	NU50B_ARATH Nuclear pore complex protein NUP50B OS=Arabidopsis thaliana OX=3702 GN=NUP50B PE=1 SV=1
16	Q8RWG8	5.20e-08	55.5	217	0.082	0.175	RBP1B_ARATH Ran-binding protein 1 homolog b OS=Arabidopsis thaliana OX=3702 GN=RANBP1B PE=1 SV=2
17	Q09146	6.35e-07	53.9	399	0.073	0.085	HBA1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hba1 PE=1 SV=1
18	P41920	4.40e-06	49.7	201	0.054	0.124	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
19	A0A1D8PRQ3	4.60e-05	46.6	212	0.054	0.118	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
20	D4A054	7.31e-05	48.1	3061	0.075	0.011	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00638 Ran_BP1	4e-09	48.2	RanBP1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421853

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358812	0.709	Protein RRP5 homolog
2	9606.ENSP00000296603	0.575	Recruited to ligand-activated beta-2 adrenergic receptor/ADRB2, it negatively regulates the adrenergic receptor signaling pathway . May also regulate other G-protein coupled receptors including type-1 angiotensin II receptor/AGTR1 (Probable)
3	9606.ENSP00000265107	0.566	WD repeat-containing protein 70
4	9606.ENSP00000307746	0.566	Zinc finger protein 608
5	9606.ENSP00000299871	0.551	Zinc finger protein 211
6	9606.ENSP00000419454	0.541	Probable E3 ubiquitin-protein ligase RNF183
7	9606.ENSP00000371362	0.536	NAD kinase 2, mitochondrial
8	9606.ENSP00000279024	0.534	Uncharacterized protein KIAA1755
9	9606.ENSP00000426387	0.530	Zinc finger and BTB domain-containing protein 38
10	9606.ENSP00000302222	0.524	Zinc finger protein 25
11	9606.ENSP00000358714	0.513	Belongs to the peptidase S1 family
12	9606.ENSP00000282507	0.511	UDP-glucuronosyltransferase 3A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046332	1.000	SMAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0048519	0.813	negative regulation of biological process
GO:0048523	0.790	negative regulation of cellular process
GO:0032502	0.711	developmental process
GO:0048518	0.656	positive regulation of biological process
GO:0048522	0.651	positive regulation of cellular process
GO:0045595	0.617	regulation of cell differentiation
GO:0032501	0.518	multicellular organismal process
GO:0048856	0.515	anatomical structure development
GO:0007275	0.449	multicellular organism development
GO:0051093	0.428	negative regulation of developmental process
GO:0048513	0.425	animal organ development
GO:0045596	0.415	negative regulation of cell differentiation
GO:0030154	0.413	cell differentiation
GO:0048731	0.386	system development
GO:0009888	0.385	tissue development
GO:0001501	0.383	skeletal system development
GO:0045597	0.381	positive regulation of cell differentiation
GO:0045667	0.372	regulation of osteoblast differentiation
GO:0048762	0.337	mesenchymal cell differentiation
GO:0045661	0.309	regulation of myoblast differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0005737	0.995	cytoplasm
GO:0005654	0.991	nucleoplasm
GO:0005829	0.546	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]