StarFunc result for job id Q86VV8

User Input

>input (2226 residues)
MVLAGLIRKLGHQLAEIRERALKSILCKIEHNLICYADLIQERQLFLHLLEWFNFPSVPM
KEEVLNLLSRLVKYPPAVQHLVDVGAVEFLSKLRSNVEPNLQAEIDGILDGLFLLPSEVP
ALSSASYQTNQTELSKNPEILTGYFPQDKSNFQQMEVPPRPVVNQTVKCLKFSTFPWLPL
TTTDRHVLSSNESSLRSSNHTLIWNTCELLKDVIMQDFPAEIFLQRPKIVQSLLSLLKLA
FGDGKHRLALQSVSCLQQLCMYLRNRLNFHRDPGFFSNKHDTVSQNSSLSYCHEARGTHH
SQNPSPGSSSPRPSVVGRTGQRPRGDGQDWDAASSSGSSSHAHVNSRISVHSPLDMGHID
LPELETEDTLELQFQQLSLPQFCVSILESAVPLLRTGSRQVIIRVLELLTEDMTLIGEAI
STDIWDDSSLFGIDMKEKLLLVLGALGETMCYHKSSISLEQPEVMLVHHRMAFISISLFA
VRLLQTLLPVEKASEFLSEPMSTALFLLSLDMPISLEYPNIHEAVVAYLEQLNSENYSIY
KRTAEAVYSIECTCNFLSDIGKEGEKNLLELVELADQALRSFSYHQHFPLIKEIISICSK
IWKSAQASPLLQGESQKVLLHMLSHPLPRVKAETYHCCLEITKECLGVHNVTKPVSSLCN
GIHFLLHPKVLYEISVFGIQEPESEVNTAAKAILLYLLQGRLMMTALTWNKFIESLCPVI
PILQGYADTEDPLGNCILLLSKASSDTEEMLPCTTRLKSMLRLLLVKKPSVRSLALKLLA
FHLTSEEGADTKRPLIDARVLSRVTDLFIGKKPIELRLDDRRELVIKLETVEKVYEIFTS
DDVDLVLRKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVVECLVQPCL
TLLRKVLCGDPVMRVSLSQQSSLLTVLFRVSLIFHEDCSVVTEVGALFCLLLFDEVSRMD
MWSVNPSNKPSLPSVFSLPVSVFRRYHLPVHVIGHHAVSPYSIVLPLSADCLALKPVSDM
LRIAWNLSWYHGSDNLLKQMNSETKTQEILDALKLSTEDILTLKITHMASGLQDCLHSIV
QAATHREVRAAVTRMSFYLLNDRLSLKGCPGPCGVTLKSLAWHTALNRFLQVLPACTEDE
KLLIDIIHFLNKLIKEQRKNSSLELLNWILELLLRHSANPLLDLLVLTESQAREETDDIR
TAVRQQLQKELIALFDTLLLNFMEVTDRKCSELLYVFQTQLALKLLQCLKVTDAPHFYGL
PSLERTLRGMANLTAFPGWSSHSPLTKPLDICVKYLSGLLEVITSFYVERGGNAMSFMGK
GVTKSTILCLLHLSHEMMAQAGSLEWMSLWFLPLGSHSEEHIPTQQGLAWLIPLWVDRDP
EVRFTSLGLGSALTTLETGCVALANSCQNISGGLWGTVVNILLDQSECSMVRREAAFILQ
NLLVIPMPTEIIKDYTWQGPCVHDEDSGLSLIGKPALQALLYHCHFYEHLNQMVKHCYLG
RCMFDLNFSAFDRNSESNDLNGLDDSFKFWRAPSRTSQDRDPSSLSTSETTVAPSLGSTE
FQPLVQSTTLLPEASHDQFVAQGHQESTSPRPPHDSSLSAPLPKLCVFVTPSLLSAMCSL
LDNLLTIAPRDTAKAFRQAHLIELLCSIADATLIQTCVQELRALLPSSPPAEHTQAQVSF
LLEYLSSLSRLLQSCLLVEPDLVIQDELVKPLITNIIGILTICTKDVLDKELISAFYHTW
THLFNLLAMLLRKAGAITLPFVTVALAKHWTAAIDMFCTCAGLSATCPALYTASLQFLSV
LLTEEAKGHLQAKSKTHLCCSPTVASLLDDSQENQKSLEQLSDVILQCYEGKSSKDILKR
VAANALMSLLAVSRRAQKHALKANLIDNCMEQMKHINAQLNLDSLRPGKAALKKKEDGVI
KELSIAMQLLRNCLYQNEECKEAALEAHLVPVLHSLWPWILMDDSLMQISLQLLCVYTAN
FPNGCSSLCWSSCGQHPVQATHRGAVSNSLMLCILKLASQMPLENTTVQQMVFMLLSNLA
LSHDCKGVIQKSNFLQNFLSLALPKGGNKHLSNLTILWLKLLLNISSGEDGQQMILRLDG
CLDLLTEMSKYKHKSSPLLPLLIFHNVCFSPANKPKILANEKVITVLAACLESENQNAQR
IGAAALWALIYNYQKAKTALKSPSVKRRVDEAYSLAKKTFPNSEANPLNAYYLKCLENLV
QLLNSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VV8	1.000	1.000	0.000	2226	1.000	1.000	Q86VV8.pdb.gz	RTTN_HUMAN Rotatin OS=Homo sapiens OX=9606 GN=RTTN PE=1 SV=3
2	AFDB:Q8R4Y8	0.776	0.776	0.000	2226	0.823	0.823	Q8R4Y8.pdb.gz	RTTN_MOUSE Rotatin OS=Mus musculus OX=10090 GN=Rttn PE=1 SV=2
3	PDB:6x9oA	0.110	0.103	2.766E-10	2425	0.131	0.120	6x9oA.pdb.gz
4	PDB:6ez8A	0.108	0.103	4.103E-10	2353	0.128	0.121	6ez8A.pdb.gz
5	PDB:7t3pA	0.126	0.134	6.777E-10	2066	0.091	0.098	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
6	PDB:7sukSP	0.116	0.115	8.710E-10	2234	0.122	0.121	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
7	PDB:7mp6B	0.131	0.172	1.292E-9	1609	0.097	0.134	7mp6B.pdb.gz
8	PDB:4a0cA	0.151	0.253	2.134E-9	1155	0.087	0.167	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
9	PDB:7m6aA	0.113	0.071	2.134E-9	4306	0.111	0.057	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
10	PDB:7mq8LM	0.100	0.109	2.376E-9	2005	0.113	0.126	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7mqaLM	0.087	0.093	2.376E-9	2041	0.113	0.123	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7ajuUT	0.105	0.102	2.463E-9	2313	0.123	0.118	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	AFDB:F4HRS2	0.140	0.140	4.724E-9	2222	0.114	0.114	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
14	AFDB:Q8RWY6	0.083	0.109	4.724E-9	1439	0.091	0.140	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
15	AFDB:Q95Q95	0.091	0.077	6.522E-9	2697	0.117	0.097	Q95Q95.pdb.gz	TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans OX=6239 GN=let-363 PE=2 SV=3
16	AFDB:Q388H0	0.132	0.227	1.828E-7	1133	0.059	0.117	Q388H0.pdb.gz	Q388H0_TRYB2 Armadillo/beta-catenin-like repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2450 PE=4 SV=1
17	AFDB:Q9SXA1	0.075	0.081	8.239E-7	2028	0.108	0.119	Q9SXA1.pdb.gz	P4KA1_ARATH Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PI4KA1 PE=1 SV=2
18	AFDB:Q96UP3	0.067	0.096	1.687E-6	1400	0.081	0.129	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
19	AFDB:Q9BZ29	0.095	0.099	4.134E-6	2069	0.075	0.081	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
20	AFDB:Q6DFZ1	0.075	0.086	7.881E-6	1861	0.108	0.130	Q6DFZ1.pdb.gz	Q6DFZ1_MOUSE Golgi-specific brefeldin A-resistance factor 1 OS=Mus musculus OX=10090 GN=Gbf1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VV8	0.0	4548	2226	1.000	1.000	RTTN_HUMAN Rotatin OS=Homo sapiens OX=9606 GN=RTTN PE=1 SV=3
2	Q8R4Y8	0.0	3564	2226	0.823	0.823	RTTN_MOUSE Rotatin OS=Mus musculus OX=10090 GN=Rttn PE=1 SV=2
3	A1Z8X3	0.008	43.9	1977	0.035	0.039	RTTN_DROME Protein rotatin homolog OS=Drosophila melanogaster OX=7227 GN=ana3 PE=1 SV=1
4	H9A0J9	0.75	36.6	231	0.012	0.113	H9A0J9_DANRE Interleukin-6 OS=Danio rerio OX=7955 GN=il6 PE=2 SV=1
5	Q386L7	3.2	35.0	375	0.014	0.085	Q386L7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0450 PE=4 SV=1
6	P34609	3.7	35.0	1190	0.015	0.029	JIP_CAEEL JNK-interacting protein OS=Caenorhabditis elegans OX=6239 GN=unc-16 PE=1 SV=4
7	Q9FUJ3	5.0	34.7	501	0.008	0.036	CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=CKX2 PE=1 SV=2
8	Q9D1Q6	7.5	33.9	406	0.006	0.034	ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus OX=10090 GN=Erp44 PE=1 SV=1
9	Q9FUJ2	7.9	33.9	524	0.008	0.032	CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana OX=3702 GN=CKX4 PE=1 SV=2
10	O94446	8.7	33.9	463	0.008	0.039	ESA1_SCHPO Histone acetyltransferase mst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mst1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04826 Arm_2	6.3e+02	11.2	Armadillo-like
2	PF14726 RTTN_N	3.2e-32	122.5	Rotatin, an armadillo repeat protein, centriole functioning

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360944	0.850	SCL-interrupting locus protein
2	9606.ENSP00000372576	0.801	Coiled-coil domain containing 178
3	9606.ENSP00000287482	0.799	Spindle assembly abnormal protein 6 homolog
4	9606.ENSP00000353377	0.798	Coiled-coil domain containing 102B
5	9606.ENSP00000252992	0.752	Centrosomal protein of 85 kDa
6	9606.ENSP00000371308	0.742	Centromere protein J
7	9606.ENSP00000257287	0.735	Centrosomal protein of 135 kDa
8	9606.ENSP00000316681	0.721	Centrosomal protein of 295 kDa
9	9606.ENSP00000382976	0.717	Lethal(3)malignant brain tumor-like protein 4
10	9606.ENSP00000470152	0.682	Dystrobrevin alpha
11	9606.ENSP00000372160	0.664	Docking protein 6
12	9606.ENSP00000295872	0.660	Spindle and centriole-associated protein 1
13	9606.ENSP00000475939	0.649	Dynein heavy chain 11, axonemal
14	9606.ENSP00000262457	0.647	Inversin
15	9606.ENSP00000292330	0.628	Protein phosphatase 1 regulatory subunit 35
16	9606.ENSP00000346067	0.628	40S ribosomal protein SA
17	9606.ENSP00000384084	0.625	Dystrobrevin beta
18	9606.ENSP00000362688	0.623	Eukaryotic translation initiation factor 3 subunit I
19	9606.ENSP00000403172	0.623	60S ribosomal protein L6
20	9606.ENSP00000429374	0.623	Ribosomal protein S20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.797	multicellular organismal process
GO:0060972	0.791	left/right pattern formation
GO:0009855	0.787	determination of bilateral symmetry
GO:0009987	0.729	cellular process
GO:0007368	0.623	determination of left/right symmetry
GO:0050789	0.595	regulation of biological process
GO:0050794	0.456	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005814	0.998	centriole
GO:0036064	0.998	ciliary basal body
GO:0005813	0.996	centrosome
GO:0070013	0.961	intracellular organelle lumen
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0005737	0.956	cytoplasm
GO:0005634	0.891	nucleus
GO:0016020	0.860	membrane
GO:0005829	0.829	cytosol
GO:0032991	0.776	protein-containing complex
GO:0031981	0.701	nuclear lumen
GO:0012505	0.461	endomembrane system
GO:0005654	0.402	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]