StarFunc result for job id Q86VX2

User Input

>input (200 residues)
MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATT
NQISLGSLRSIVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTL
ARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLP
QFYSFLHEMERVRTSMECFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VX2	1.000	1.000	9.279E-32	200	1.000	1.000	Q86VX2.pdb.gz	COMD7_HUMAN COMM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=COMMD7 PE=1 SV=2
2	AFDB:H3BM91	0.582	0.555	7.438E-10	211	0.180	0.171	H3BM91.pdb.gz	H3BM91_HUMAN COMM domain containing 4 (Fragment) OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
3	AFDB:Q9Y6G5	0.572	0.566	5.512E-9	202	0.135	0.134	Q9Y6G5.pdb.gz	COMDA_HUMAN COMM domain-containing protein 10 OS=Homo sapiens OX=9606 GN=COMMD10 PE=1 SV=1
4	AFDB:Q9ERR2	0.651	0.591	1.891E-8	224	0.170	0.152	Q9ERR2.pdb.gz	COMD5_RAT COMM domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Commd5 PE=2 SV=1
5	AFDB:Q8K2Q0	0.480	0.484	2.322E-8	198	0.115	0.116	Q8K2Q0.pdb.gz	COMD9_MOUSE COMM domain-containing protein 9 OS=Mus musculus OX=10090 GN=Commd9 PE=1 SV=3
6	AFDB:A0A0B4J287	0.480	0.530	2.852E-8	177	0.170	0.192	A0A0B4J287.pdb.gz	A0A0B4J287_HUMAN COMM domain containing 4 OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
7	AFDB:Q9GZQ3	0.645	0.587	3.687E-8	224	0.155	0.138	Q9GZQ3.pdb.gz	COMD5_HUMAN COMM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=COMMD5 PE=1 SV=1
8	AFDB:Q86X83	0.564	0.567	6.486E-8	199	0.135	0.136	Q86X83.pdb.gz	COMD2_HUMAN COMM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=COMMD2 PE=1 SV=2
9	AFDB:Q9UBI1	0.527	0.538	6.486E-8	195	0.130	0.133	Q9UBI1.pdb.gz	COMD3_HUMAN COMM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=COMMD3 PE=1 SV=1
10	AFDB:Q53FR9	0.485	0.489	1.265E-7	198	0.120	0.121	Q53FR9.pdb.gz	Q53FR9_HUMAN COMM domain containing 9 variant (Fragment) OS=Homo sapiens OX=9606 GN=COMMD9 PE=2 SV=1
11	PDB:7r97A	0.152	0.139	7.540E-2	226	0.120	0.106	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
12	PDB:5imjA	0.143	0.127	8.796E-2	246	0.155	0.126	5imjA.pdb.gz
13	PDB:1yykA	0.167	0.158	2.334E-1	221	0.120	0.109	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
14	PDB:3dhrA	0.150	0.182	4.551E-1	141	0.085	0.121	3dhrA.pdb.gz	Purification, Crystallization and X-ray Diffraction Studies of Pigeon Hemoglobin
15	PDB:2b5uA	0.116	0.065	4.791E-1	470	0.110	0.047	2b5uA.pdb.gz
16	PDB:5oqmd	0.150	0.077	5.589E-1	442	0.050	0.023	5oqmd.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
17	PDB:5b5rA	0.205	0.114	8.873E-1	409	0.140	0.068	5b5rA.pdb.gz
18	PDB:6yvvB	0.122	0.065	8.873E-1	480	0.105	0.044	6yvvB.pdb.gz
19	PDB:1fdhG	0.144	0.179	9.832E-1	147	0.100	0.136	1fdhG.pdb.gz	Structure of human foetal deoxyhaemoglobin.
20	PDB:1hbrD	0.149	0.182	1.035	146	0.090	0.123	1hbrD.pdb.gz	The structural and functional analysis of the hemoglobin D component from chicken.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VX2	3.33e-148	411	200	1.000	1.000	COMD7_HUMAN COMM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=COMMD7 PE=1 SV=2
2	Q9H0A8	8.73e-06	46.6	199	0.205	0.206	COMD4_HUMAN COMM domain-containing protein 4 OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
3	A0A0B4J287	6.75e-05	43.9	177	0.155	0.175	A0A0B4J287_HUMAN COMM domain containing 4 OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
4	H3BM91	8.76e-04	41.2	211	0.185	0.175	H3BM91_HUMAN COMM domain containing 4 (Fragment) OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
5	Q7Z4G1	0.001	38.9	85	0.090	0.212	COMD6_HUMAN COMM domain-containing protein 6 OS=Homo sapiens OX=9606 GN=COMMD6 PE=1 SV=1
6	P34258	2.7	31.2	493	0.065	0.026	YKA7_CAEEL Uncharacterized protein B0303.7 OS=Caenorhabditis elegans OX=6239 GN=B0303.7 PE=1 SV=5
7	S6EPL9	6.6	30.0	602	0.075	0.025	S6EPL9_ONCMY ST2L protein OS=Oncorhynchus mykiss OX=8022 GN=IL1RL1 PE=3 SV=1
8	Q9NJA2	7.6	30.0	1112	0.165	0.030	Q9NJA2_DROME Adenylyl cyclase ACXA OS=Drosophila melanogaster OX=7227 GN=ACXA PE=2 SV=1
9	Q9VK51	8.0	29.6	1112	0.165	0.030	Q9VK51_DROME Adenylyl cyclase X A, isoform A OS=Drosophila melanogaster OX=7227 GN=ACXA PE=4 SV=3
10	P29691	8.1	29.6	852	0.055	0.013	EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans OX=6239 GN=eef-2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07258 COMM_domain	6.5e-12	56.9	COMM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274458	0.973	COMM domain-containing protein 10
2	9606.ENSP00000365401	0.970	Coiled-coil domain-containing protein 22
3	9606.ENSP00000308236	0.967	COMM domain-containing protein 1
4	9606.ENSP00000267935	0.963	COMM domain-containing protein 4
5	9606.ENSP00000370984	0.952	COMM domain-containing protein 8
6	9606.ENSP00000366032	0.941	COMM domain-containing protein 3
7	9606.ENSP00000419475	0.917	COMM domain-containing protein 2
8	9606.ENSP00000304102	0.909	COP9 signalosome complex subunit 6
9	9606.ENSP00000348054	0.909	COMM domain containing 6
10	9606.ENSP00000299259	0.907	COP9 signalosome complex subunit 2
11	9606.ENSP00000350512	0.907	COP9 signalosome complex subunit 5
12	9606.ENSP00000264389	0.906	COP9 signalosome complex subunit 4
13	9606.ENSP00000268717	0.906	COP9 signalosome complex subunit 3
14	9606.ENSP00000346340	0.906	COP9 signalosome complex subunit 8
15	9606.ENSP00000362710	0.906	COP9 signalosome complex subunit 7b
16	9606.ENSP00000376167	0.906	COP9 signalosome complex subunit 1
17	9606.ENSP00000364794	0.902	Isoleucine--tRNA ligase, cytoplasmic
18	9606.ENSP00000438115	0.902	COP9 signalosome complex subunit 7a
19	9606.ENSP00000363019	0.901	Ubiquitin-conjugating enzyme E2 D1
20	9606.ENSP00000349722	0.900	Ubiquitin conjugating enzyme E2 D3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051059	1.000	NF-kappaB binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.957	response to stimulus
GO:0048523	0.957	negative regulation of cellular process
GO:0051716	0.953	cellular response to stimulus
GO:0080090	0.931	regulation of primary metabolic process
GO:0051171	0.930	regulation of nitrogen compound metabolic process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0007165	0.912	signal transduction
GO:0010468	0.909	regulation of gene expression
GO:0010605	0.899	negative regulation of macromolecule metabolic process
GO:0031324	0.897	negative regulation of cellular metabolic process
GO:0010556	0.894	regulation of macromolecule biosynthetic process
GO:0031326	0.894	regulation of cellular biosynthetic process
GO:0042221	0.880	response to chemical
GO:0019219	0.880	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.874	regulation of RNA metabolic process
GO:0006355	0.842	regulation of DNA-templated transcription
GO:0034097	0.833	response to cytokine
GO:0045892	0.831	negative regulation of DNA-templated transcription
GO:0070887	0.826	cellular response to chemical stimulus
GO:0065009	0.823	regulation of molecular function
GO:0071345	0.821	cellular response to cytokine stimulus
GO:0051090	0.792	regulation of DNA-binding transcription factor activity
GO:0043433	0.762	negative regulation of DNA-binding transcription factor activity
GO:0034612	0.734	response to tumor necrosis factor
GO:0007166	0.724	cell surface receptor signaling pathway
GO:0019221	0.702	cytokine-mediated signaling pathway
GO:0032088	0.694	negative regulation of NF-kappaB transcription factor activity
GO:0071356	0.646	cellular response to tumor necrosis factor
GO:0033209	0.533	tumor necrosis factor-mediated signaling pathway
GO:0071704	0.397	organic substance metabolic process
GO:0044238	0.339	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.990	intracellular organelle lumen
GO:0005829	0.979	cytosol
GO:0031981	0.973	nuclear lumen
GO:0032991	0.962	protein-containing complex
GO:0005654	0.943	nucleoplasm
GO:0031982	0.917	vesicle
GO:0012505	0.872	endomembrane system
GO:0016020	0.801	membrane
GO:0097708	0.739	intracellular vesicle
GO:0031410	0.715	cytoplasmic vesicle
GO:1902494	0.692	catalytic complex
GO:0071944	0.576	cell periphery
GO:0005886	0.527	plasma membrane
GO:0031461	0.459	cullin-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]