StarFunc result for job id Q86VY4

User Input

>input (417 residues)
MSGRSRGRKSSRAKNRGKGRAKARVRPAPDDAPRDPDPSQYQSLGEDTQAAQVQAGAGWG
GLEAAASAQLLRLGEEAACRLPLDCGLALRARAAGDHGQAAARPGPGKAASLSERLAADT
VFVGTAGTVGRPKNAPRVGNRRGPAGKKAPETCSTAGRGPQVIAGGRQKKGAAGENTSVS
AGEEKKEERDAGSGPPATEGSMDTLENVQLKLENMNAQADRAYLRLSRKFGQLRLQHLER
RNHLIQNIPGFWGQAFQNHPQLASFLNSQEKEVLSYLNSLEVEELGLARLGYKIKFYFDR
NPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSFFGWFSNHSSI
ESDKIVEIINEELWPNPLQFYLLSEGARVEKGKEKEGRQGPGKQPMETTQPGVSQSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VY4	0.999	0.999	2.336E-64	417	1.000	1.000	Q86VY4.pdb.gz	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
2	AFDB:Q9UJ04	0.426	0.429	1.003E-25	414	0.441	0.444	Q9UJ04.pdb.gz	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
3	AFDB:Q8N831	0.445	0.452	4.918E-23	410	0.353	0.359	Q8N831.pdb.gz	TSYL6_HUMAN Testis-specific Y-encoded-like protein 6 OS=Homo sapiens OX=9606 GN=TSPYL6 PE=1 SV=1
4	AFDB:Q63945	0.438	0.618	5.048E-21	289	0.199	0.287	Q63945.pdb.gz	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
5	AFDB:P0DME0	0.438	0.592	8.673E-21	302	0.209	0.288	P0DME0.pdb.gz	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
6	AFDB:A0A2R8QJ70	0.431	0.613	5.270E-20	287	0.189	0.275	A0A2R8QJ70.pdb.gz
7	AFDB:Q9R1M3	0.382	0.469	9.704E-17	334	0.221	0.275	Q9R1M3.pdb.gz	TSPY1_RAT Testis-specific Y-encoded protein 1 OS=Rattus norvegicus OX=10116 GN=Tspy1 PE=1 SV=2
8	PDB:7c7xE	0.380	0.881	6.045E-14	174	0.151	0.362	7c7xE.pdb.gz
9	PDB:5gpkB	0.328	0.613	4.252E-11	207	0.096	0.193	5gpkB.pdb.gz
10	PDB:3fs3A	0.373	0.755	2.743E-10	197	0.103	0.218	3fs3A.pdb.gz
11	PDB:3q66A	0.358	0.588	6.648E-9	236	0.098	0.174	3q66A.pdb.gz
12	PDB:7un6B	0.335	0.544	4.838E-8	240	0.108	0.188	7un6B.pdb.gz
13	PDB:6k09A	0.296	0.437	7.828E-8	267	0.098	0.154	6k09A.pdb.gz
14	PDB:2ayuA	0.332	0.464	8.313E-8	283	0.129	0.191	2ayuA.pdb.gz
15	PDB:6n2gA	0.334	0.469	1.123E-7	285	0.120	0.175	6n2gA.pdb.gz
16	PDB:6baqF	0.088	0.145	6.542E-1	211	0.034	0.066	6baqF.pdb.gz
17	PDB:7sntB	0.086	0.218	7.378E-1	139	0.022	0.065	7sntB.pdb.gz	2.20A Resolution Structure of NanoLuc Luciferase with Bound Substrate Analog 3-methoxy-furimazine
18	AFDB:Q6DIC6	0.104	0.023	1.431	2087	0.106	0.021	Q6DIC6.pdb.gz	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
19	AFDB:B8BCZ8	0.127	0.082	2.181	738	0.139	0.079	B8BCZ8.pdb.gz	FCA_ORYSI Flowering time control protein FCA OS=Oryza sativa subsp. indica OX=39946 GN=FCA PE=3 SV=2
20	AFDB:A0A060KY90	0.110	0.080	2.316	630	0.110	0.073	A0A060KY90.pdb.gz	MYC1_SOLLC Transcription factor MYC1 OS=Solanum lycopersicum OX=4081 GN=MYC1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VY4	0.0	850	417	1.000	1.000	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
2	Q9UJ04	1.82e-93	289	414	0.420	0.423	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
3	Q9H0U9	2.55e-74	240	437	0.372	0.355	TSYL1_HUMAN Testis-specific Y-encoded-like protein 1 OS=Homo sapiens OX=9606 GN=TSPYL1 PE=1 SV=3
4	Q6FI91	1.63e-73	238	438	0.365	0.347	Q6FI91_HUMAN TSPYL protein OS=Homo sapiens OX=9606 GN=TSPYL PE=1 SV=1
5	Q8N831	6.08e-69	225	410	0.360	0.366	TSYL6_HUMAN Testis-specific Y-encoded-like protein 6 OS=Homo sapiens OX=9606 GN=TSPYL6 PE=1 SV=1
6	Q9H2G4	1.18e-59	207	693	0.254	0.153	TSYL2_HUMAN Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1
7	A6NKD2	2.66e-49	171	308	0.189	0.256	TSPY2_HUMAN Testis-specific Y-encoded protein 2 OS=Homo sapiens OX=9606 GN=TSPY2 PE=1 SV=1
8	P0CW01	3.94e-49	171	308	0.189	0.256	TSPYA_HUMAN Testis-specific Y-encoded protein 10 OS=Homo sapiens OX=9606 GN=TSPY10 PE=1 SV=2
9	Q01105	1.07e-48	169	290	0.206	0.297	SET_HUMAN Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3
10	Q5VXV3	1.07e-48	169	290	0.206	0.297	Q5VXV3_HUMAN SET OS=Homo sapiens OX=9606 GN=SET PE=2 SV=1
11	Q9EQU5	4.56e-48	167	289	0.197	0.284	SET_MOUSE Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 SV=1
12	Q63945	5.45e-48	167	289	0.199	0.287	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
13	Q6TGU0	5.99e-48	167	275	0.182	0.276	Q6TGU0_DANRE Myeloid leukemia-associated SET translocation protein OS=Danio rerio OX=7955 GN=SET PE=1 SV=1
14	Q01534	4.98e-47	165	308	0.187	0.253	TSPY1_HUMAN Testis-specific Y-encoded protein 1 OS=Homo sapiens OX=9606 GN=TSPY1 PE=1 SV=4
15	P0DME0	4.27e-45	160	302	0.199	0.275	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
16	Q9R1M3	4.42e-37	139	334	0.175	0.219	TSPY1_RAT Testis-specific Y-encoded protein 1 OS=Rattus norvegicus OX=10116 GN=Tspy1 PE=1 SV=2
17	Q9CA59	1.71e-34	130	256	0.158	0.258	NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=NRP1 PE=1 SV=1
18	Q8LC68	1.49e-32	125	255	0.161	0.263	NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=NRP2 PE=1 SV=2
19	Q18240	6.81e-25	105	312	0.146	0.196	SPR2_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=2 SV=2
20	Q7JMA9	1.32e-24	105	313	0.151	0.201	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00956 NAP	4.9e-18	76.8	Nucleosome assembly protein (NAP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322802

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343535	0.832	Ubiquitin carboxyl-terminal hydrolase 7
2	9606.ENSP00000240423	0.672	Condensin complex subunit 2
3	9606.ENSP00000337088	0.654	Menin
4	9606.ENSP00000265299	0.588	Probable ubiquitin carboxyl-terminal hydrolase MINDY-4
5	9606.ENSP00000360025	0.542	Growth arrest and DNA damage-inducible protein GADD45 alpha
6	9606.ENSP00000376946	0.522	Bardet-Biedl syndrome 10 protein
7	9606.ENSP00000362562	0.514	Transmembrane protein 54
8	9606.ENSP00000386923	0.503	Lysozyme g-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0051173	0.957	positive regulation of nitrogen compound metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0010604	0.948	positive regulation of macromolecule metabolic process
GO:0048522	0.937	positive regulation of cellular process
GO:0051246	0.911	regulation of protein metabolic process
GO:0050896	0.907	response to stimulus
GO:0051716	0.900	cellular response to stimulus
GO:0023051	0.891	regulation of signaling
GO:0010646	0.888	regulation of cell communication
GO:0048583	0.818	regulation of response to stimulus
GO:1902531	0.804	regulation of intracellular signal transduction
GO:1903320	0.799	regulation of protein modification by small protein conjugation or removal
GO:0051247	0.703	positive regulation of protein metabolic process
GO:0031401	0.655	positive regulation of protein modification process
GO:1903322	0.625	positive regulation of protein modification by small protein conjugation or removal
GO:0051896	0.623	regulation of protein kinase B signaling
GO:0048584	0.472	positive regulation of response to stimulus
GO:0016043	0.468	cellular component organization
GO:0023056	0.446	positive regulation of signaling
GO:0010647	0.446	positive regulation of cell communication
GO:0010212	0.417	response to ionizing radiation
GO:0071478	0.407	cellular response to radiation
GO:0043933	0.389	protein-containing complex organization
GO:0022607	0.375	cellular component assembly
GO:0009967	0.360	positive regulation of signal transduction
GO:0042127	0.334	regulation of cell population proliferation
GO:0010332	0.322	response to gamma radiation
GO:0031396	0.312	regulation of protein ubiquitination
GO:0071479	0.305	cellular response to ionizing radiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005737	0.869	cytoplasm
GO:0005694	0.421	chromosome
GO:0005829	0.391	cytosol
GO:0005730	0.364	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]