StarFunc result for job id Q86VZ2

User Input

>input (330 residues)
MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSS
ADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKT
LKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGS
LIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYS
RGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVV
ISAACHPTENLIASAALENDKTIKLWMSNH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4V8C4	0.947	0.953	1.050E-58	328	0.845	0.851	Q4V8C4.pdb.gz	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
2	AFDB:P61964	0.933	0.922	3.720E-58	334	0.861	0.850	P61964.pdb.gz	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
3	AFDB:Q9V3J8	0.941	0.861	7.000E-57	361	0.785	0.717	Q9V3J8.pdb.gz	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
4	PDB:2h9lA	0.934	0.960	1.173E-55	321	0.830	0.854	2h9lA.pdb.gz
5	AFDB:Q54KL5	0.930	0.917	1.382E-49	335	0.633	0.624	Q54KL5.pdb.gz	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
6	AFDB:Q17963	0.928	0.816	2.668E-49	376	0.618	0.543	Q17963.pdb.gz	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
7	AFDB:Q9M2Z2	0.906	0.943	1.823E-46	317	0.573	0.596	Q9M2Z2.pdb.gz	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
8	AFDB:Q23256	0.907	0.599	3.516E-44	501	0.512	0.337	Q23256.pdb.gz	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
9	AFDB:O43017	0.857	0.747	1.150E-34	380	0.367	0.318	O43017.pdb.gz	SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swd3 PE=1 SV=1
10	AFDB:P43033	0.863	0.699	2.273E-29	410	0.306	0.246	P43033.pdb.gz	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
11	AFDB:Q9VPL0	0.844	0.804	3.584E-29	347	0.342	0.326	Q9VPL0.pdb.gz	Q9VPL0_DROME GM13767p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3436 PE=1 SV=1
12	PDB:5o9zL	0.857	0.619	3.272E-28	459	0.261	0.187	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
13	PDB:7a5pz	0.851	0.614	4.659E-26	460	0.155	0.111	7a5pz.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
14	PDB:1vyhC	0.845	0.897	8.995E-26	310	0.306	0.326	1vyhC.pdb.gz
15	PDB:5mzhB	0.744	0.605	9.953E-26	415	0.297	0.236	5mzhB.pdb.gz
16	PDB:5nnzA	0.733	0.723	1.282E-25	335	0.291	0.287	5nnzA.pdb.gz
17	PDB:5mqfF	0.835	0.896	1.454E-24	307	0.312	0.336	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
18	PDB:5jcsq	0.731	0.512	3.802E-24	488	0.285	0.193	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
19	PDB:3dm0A	0.791	0.395	1.046E-23	675	0.267	0.130	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
20	PDB:7bt6x	0.723	0.509	4.101E-23	488	0.282	0.191	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61964	0.0	581	334	0.861	0.850	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
2	P61965	0.0	581	334	0.861	0.850	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
3	Q498M4	0.0	581	334	0.861	0.850	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
4	Q4V8C4	0.0	583	328	0.845	0.851	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
5	Q7ZTX2	0.0	560	334	0.845	0.835	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
6	Q9V3J8	0.0	540	361	0.773	0.706	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
7	Q54KL5	2.38e-157	445	335	0.618	0.609	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
8	Q17963	3.51e-153	436	376	0.609	0.535	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
9	Q9M2Z2	1.41e-135	389	317	0.585	0.609	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
10	Q23256	8.19e-124	366	501	0.512	0.337	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
11	O43017	6.45e-72	229	380	0.318	0.276	SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swd3 PE=1 SV=1
12	O22826	5.48e-54	182	343	0.333	0.321	O22826_ARATH At2g43770 OS=Arabidopsis thaliana OX=3702 GN=At2g43770 PE=1 SV=1
13	Q57W14	3.71e-53	182	419	0.324	0.255	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
14	Q7T394	1.64e-52	180	410	0.321	0.259	LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio OX=7955 GN=pafah1b1a PE=2 SV=3
15	Q803D2	3.91e-52	179	410	0.318	0.256	LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio OX=7955 GN=pafah1b1b PE=2 SV=3
16	Q8N136	7.06e-52	178	415	0.303	0.241	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
17	P63004	7.71e-52	178	410	0.318	0.256	LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus OX=10116 GN=Pafah1b1 PE=1 SV=2
18	P63005	7.71e-52	178	410	0.318	0.256	LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus OX=10090 GN=Pafah1b1 PE=1 SV=2
19	P43034	8.39e-52	178	410	0.318	0.256	LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2
20	P43033	8.66e-52	178	410	0.318	0.256	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.2e-20	84.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF19235 DUF5888	6.7e+02	11.6	Family of unknown function (DUF5888)
3	PF08662 eIF2A	1.2e-09	49.9	Eukaryotic translation initiation factor eIF2A
4	PF16529 Ge1_WD40	0.0016	29.1	WD40 region of Ge1, enhancer of mRNA-decapping protein
5	PF20426 NBCH_WD40	1.3e-16	72.0	Neurobeachin beta propeller domain
6	PF11715 Nup160	2e-07	41.8	Nucleoporin Nup120/160
7	PF07676 PD40	5.5e+02	12.0	WD40-like Beta Propeller Repeat
8	PF00652 Ricin_B_lectin	2.3e+02	13.4	Ricin-type beta-trefoil lectin domain
9	PF00400 WD40	5.3e-56	196.5	WD domain, G-beta repeat
10	PF17005 WD40_like	0.004	28.1	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340896	0.915	Set1/Ash2 histone methyltransferase complex subunit ASH2
2	9606.ENSP00000264515	0.909	Retinoblastoma-binding protein 5
3	9606.ENSP00000301067	0.873	Histone-lysine N-methyltransferase 2D
4	9606.ENSP00000436786	0.833	Histone-lysine N-methyltransferase 2A
5	9606.ENSP00000351446	0.820	WD repeat-containing protein 5
6	9606.ENSP00000337088	0.810	Menin
7	9606.ENSP00000296490	0.744	WD repeat-containing protein 82
8	9606.ENSP00000345837	0.713	Protein dpy-30 homolog
9	9606.ENSP00000262519	0.710	Histone-lysine N-methyltransferase SETD1A
10	9606.ENSP00000442924	0.710	Histone-lysine N-methyltransferase SETD1B
11	9606.ENSP00000390475	0.683	CXXC-type zinc finger protein 1
12	9606.ENSP00000309555	0.663	Host cell factor 1
13	9606.ENSP00000428002	0.601	Putative uncharacterized protein C8orf44
14	9606.ENSP00000361272	0.550	DPY30 domain containing 2
15	9606.ENSP00000361278	0.550	DPY30 domain-containing protein 1
16	9606.ENSP00000291458	0.540	Coiled-coil domain containing 58

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.988	regulation of biological process
GO:0032501	0.986	multicellular organismal process
GO:0019222	0.967	regulation of metabolic process
GO:0032502	0.952	developmental process
GO:0050794	0.917	regulation of cellular process
GO:0060255	0.868	regulation of macromolecule metabolic process
GO:0048856	0.806	anatomical structure development
GO:0016043	0.791	cellular component organization
GO:0007275	0.744	multicellular organism development
GO:0010468	0.710	regulation of gene expression
GO:0048518	0.699	positive regulation of biological process
GO:0009893	0.671	positive regulation of metabolic process
GO:0071704	0.656	organic substance metabolic process
GO:0044238	0.638	primary metabolic process
GO:0048731	0.631	system development
GO:0006807	0.618	nitrogen compound metabolic process
GO:0080090	0.611	regulation of primary metabolic process
GO:0010604	0.609	positive regulation of macromolecule metabolic process
GO:0051171	0.577	regulation of nitrogen compound metabolic process
GO:0043170	0.556	macromolecule metabolic process
GO:0044237	0.511	cellular metabolic process
GO:0031323	0.457	regulation of cellular metabolic process
GO:1901564	0.434	organonitrogen compound metabolic process
GO:0009889	0.424	regulation of biosynthetic process
GO:0048522	0.419	positive regulation of cellular process
GO:0051173	0.384	positive regulation of nitrogen compound metabolic process
GO:0031326	0.375	regulation of cellular biosynthetic process
GO:0019538	0.375	protein metabolic process
GO:0018193	0.371	peptidyl-amino acid modification
GO:0031325	0.368	positive regulation of cellular metabolic process
GO:0010556	0.361	regulation of macromolecule biosynthetic process
GO:0018205	0.342	peptidyl-lysine modification
GO:0016570	0.333	histone modification
GO:0050896	0.319	response to stimulus
GO:0019219	0.318	regulation of nucleobase-containing compound metabolic process
GO:0044260	0.313	cellular macromolecule metabolic process
GO:0006338	0.311	chromatin remodeling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0048188	0.964	Set1C/COMPASS complex
GO:0005694	0.702	chromosome
GO:0000785	0.687	chromatin
GO:0044666	0.643	MLL3/4 complex
GO:0005737	0.621	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]