StarFunc result for job id Q86W10

User Input

>input (505 residues)
MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHKEF
YPVKEFEVYHKLMEKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESW
VGRGLVTLDGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELF
QHVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQRMNNFLHHNDLVFKFS
SQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRWDFLDILLSAKSENTKDFS
EADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGDGSSITWEHLS
QMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWED
PQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHS
RPPQPVRQVVLKSKNGIHVFAKKVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W10	1.000	1.000	5.676E-81	505	1.000	1.000	Q86W10.pdb.gz	CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens OX=9606 GN=CYP4Z1 PE=1 SV=1
2	AFDB:P24464	0.940	0.934	2.290E-51	508	0.509	0.506	P24464.pdb.gz	CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus OX=10116 GN=Cyp4a12 PE=1 SV=2
3	AFDB:Q02928	0.942	0.917	3.023E-51	519	0.511	0.497	Q02928.pdb.gz	CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens OX=9606 GN=CYP4A11 PE=1 SV=1
4	AFDB:A2A974	0.939	0.933	4.376E-51	508	0.489	0.486	A2A974.pdb.gz	CP4CB_MOUSE Cytochrome P450 4A12B OS=Mus musculus OX=10090 GN=Cyp4a12b PE=1 SV=1
5	AFDB:O88833	0.950	0.943	4.029E-50	509	0.481	0.477	O88833.pdb.gz	CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus OX=10090 GN=Cyp4a10 PE=1 SV=2
6	AFDB:Q8N118	0.948	0.941	2.944E-49	509	0.535	0.530	Q8N118.pdb.gz	CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens OX=9606 GN=CYP4X1 PE=1 SV=1
7	AFDB:P20817	0.945	0.941	1.179E-48	507	0.485	0.483	P20817.pdb.gz	CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus OX=10116 GN=Cyp4a14 PE=1 SV=2
8	AFDB:P15129	0.944	0.933	1.137E-47	511	0.448	0.442	P15129.pdb.gz	CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus OX=10116 GN=Cyp4b1 PE=1 SV=3
9	AFDB:P13584	0.940	0.929	2.764E-46	511	0.451	0.446	P13584.pdb.gz	CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens OX=9606 GN=CYP4B1 PE=1 SV=2
10	AFDB:P33274	0.889	0.858	3.493E-41	524	0.412	0.397	P33274.pdb.gz	CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus OX=10116 GN=Cyp4f1 PE=1 SV=1
11	PDB:5te8B	0.772	0.824	1.205E-24	471	0.236	0.253	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
12	PDB:7mk8B	0.738	0.796	1.590E-24	465	0.232	0.252	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
13	PDB:5veuC	0.762	0.816	1.682E-23	469	0.232	0.249	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
14	PDB:2j0dB	0.736	0.828	9.309E-23	445	0.230	0.261	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
15	PDB:7n3mAAA	0.776	0.891	2.140E-22	437	0.216	0.249	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
16	PDB:5veuL	0.720	0.805	5.397E-22	448	0.224	0.252	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
17	PDB:3k9vA	0.775	0.838	7.813E-22	464	0.184	0.200	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
18	PDB:7kvjA	0.679	0.818	1.637E-21	415	0.222	0.270	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.
19	PDB:3c6gB	0.770	0.827	3.309E-20	467	0.192	0.208	3c6gB.pdb.gz	Structural analysis of CYP2R1 in complex with vitamin D3.
20	PDB:3na1A	0.769	0.819	5.255E-20	472	0.174	0.186	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88833	0.0	522	509	0.469	0.466	CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus OX=10090 GN=Cyp4a10 PE=1 SV=2
2	P08516	0.0	529	509	0.475	0.472	CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus OX=10116 GN=Cyp4a10 PE=1 SV=2
3	P24464	0.0	529	508	0.497	0.494	CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus OX=10116 GN=Cyp4a12 PE=1 SV=2
4	Q02928	0.0	520	519	0.497	0.484	CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens OX=9606 GN=CYP4A11 PE=1 SV=1
5	Q86W10	0.0	1051	505	1.000	1.000	CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens OX=9606 GN=CYP4Z1 PE=1 SV=1
6	Q8N118	0.0	559	509	0.537	0.532	CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens OX=9606 GN=CYP4X1 PE=1 SV=1
7	A2A974	4.22e-177	509	508	0.481	0.478	CP4CB_MOUSE Cytochrome P450 4A12B OS=Mus musculus OX=10090 GN=Cyp4a12b PE=1 SV=1
8	Q91WL5	1.86e-176	508	508	0.479	0.476	CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus OX=10090 GN=Cyp4a12a PE=1 SV=2
9	Q5TCH4	5.60e-176	506	519	0.489	0.476	CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens OX=9606 GN=CYP4A22 PE=1 SV=1
10	P20817	2.78e-174	502	507	0.471	0.469	CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus OX=10116 GN=Cyp4a14 PE=1 SV=2
11	P20816	7.05e-173	498	504	0.475	0.476	CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus OX=10116 GN=Cyp4a2 PE=1 SV=2
12	P15129	6.65e-163	473	511	0.450	0.444	CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus OX=10116 GN=Cyp4b1 PE=1 SV=3
13	P13584	2.28e-158	461	511	0.442	0.436	CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens OX=9606 GN=CYP4B1 PE=1 SV=2
14	P78329	5.14e-131	392	520	0.414	0.402	CP4F2_HUMAN Cytochrome P450 4F2 OS=Homo sapiens OX=9606 GN=CYP4F2 PE=1 SV=1
15	P98187	1.34e-128	386	520	0.398	0.387	CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens OX=9606 GN=CYP4F8 PE=1 SV=1
16	Q9HCS2	1.97e-128	385	524	0.396	0.382	CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens OX=9606 GN=CYP4F12 PE=1 SV=3
17	P33274	4.68e-128	384	524	0.408	0.393	CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus OX=10116 GN=Cyp4f1 PE=1 SV=1
18	P51869	6.43e-126	379	522	0.384	0.372	CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus OX=10116 GN=Cyp4f4 PE=1 SV=1
19	Q08477	2.17e-124	375	520	0.400	0.388	CP4F3_HUMAN Cytochrome P450 4F3 OS=Homo sapiens OX=9606 GN=CYP4F3 PE=1 SV=2
20	Q9HBI6	3.50e-124	375	524	0.404	0.389	CP4FB_HUMAN Cytochrome P450 4F11 OS=Homo sapiens OX=9606 GN=CYP4F11 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	2.3e-117	404.3	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419970	0.666	NADPH--cytochrome P450 reductase
2	9606.ENSP00000348380	0.640	Cytochrome P450 family 20 subfamily A member 1
3	9606.ENSP00000360968	0.581	Cytochrome P450 family 4 subfamily X member 1
4	9606.ENSP00000209929	0.532	Dimethylaniline monooxygenase [N-oxide-forming] 2
5	9606.ENSP00000481732	0.523	Dimethylaniline monooxygenase [N-oxide-forming] 1
6	9606.ENSP00000254090	0.513	Dimethylaniline monooxygenase [N-oxide-forming] 5
7	9606.ENSP00000260970	0.509	Peptidyl-prolyl cis-trans isomerase G
8	9606.ENSP00000296412	0.503	Alcohol dehydrogenase class-3
9	9606.ENSP00000356723	0.500	Dimethylaniline monooxygenase [N-oxide-forming] 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0005488	0.822	binding
GO:0008391	0.764	arachidonic acid monooxygenase activity
GO:0016709	0.693	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0036094	0.308	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.996	lipid metabolic process
GO:0006082	0.995	organic acid metabolic process
GO:0019752	0.994	carboxylic acid metabolic process
GO:0033559	0.959	unsaturated fatty acid metabolic process
GO:0120254	0.946	olefinic compound metabolic process
GO:0006690	0.936	icosanoid metabolic process
GO:0019369	0.926	arachidonic acid metabolic process
GO:1901360	0.340	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031090	0.995	organelle membrane
GO:0005789	0.991	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.13.-	0.693	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.

[back to server]