StarFunc result for job id Q86W24

User Input

>input (1093 residues)
MADSSSSSFFPDFGLLLYLEELNKEELNTFKLFLKETMEPEHGLTPWNEVKKARREDLAN
LMKKYYPGEKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVL
GDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVKTGAQPQIVV
LQGAAGVGKTTLVRKAMLDWAEGSLYQQRFKYVFYLNGREINQLKERSFAQLISKDWPST
EGPIEEIMYQPSSLLFIIDSFDELNFAFEEPEFALCEDWTQEHPVSFLMSSLLRKVMLPE
ASLLVTTRLTTSKRLKQLLKNHHYVELLGMSEDAREEYIYQFFEDKRWAMKVFSSLKSNE
MLFSMCQVPLVCWAACTCLKQQMEKGGDVTLTCQTTTALFTCYISSLFTPVDGGSPSLPN
QAQLRRLCQVAAKGIWTMTYVFYRENLRRLGLTQSDVSSFMDSNIIQKDAEYENCYVFTH
LHVQEFFAAMFYMLKGSWEAGNPSCQPFEDLKSLLQSTSYKDPHLTQMKCFLFGLLNEDR
VKQLERTFNCKMSLKIKSKLLQCMEVLGNSDYSPSQLGFLELFHCLYETQDKAFISQAMR
CFPKVAINICEKIHLLVSSFCLKHCRCLRTIRLSVTVVFEKKILKTSLPTNTWDGDRITH
CWQDLCSVLHTNEHLRELDLYHSNLDKSAMNILHHELRHPNCKLQKLLLKFITFPDGCQD
ISTSLIHNKNLMHLDLKGSDIGDNGVKSLCEALKHPECKLQTLRLESCNLTVFCCLNISN
ALIRSQSLIFLNLSTNNLLDDGVQLLCEALRHPKCYLERLSLESCGLTEAGCEYLSLALI
SNKRLTHLCLADNVLGDGGVKLMSDALQHAQCTLKSLVLRRCHFTSLSSEYLSTSLLHNK
SLTHLDLGSNWLQDNGVKLLCDVFRHPSCNLQDLELMGCVLTNACCLDLASVILNNPNLR
SLDLGNNDLQDDGVKILCDALRYPNCNIQRLGLEYCGLTSLCCQDLSSALICNKRLIKMN
LTQNTLGYEGIVKLYKVLKSPKCKLQVLGLCKEAFDEEAQKLLEAVGVSNPHLIIKPDCN
YHNEEDVSWWWCF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W24	1.000	1.000	0.000	1093	1.000	1.000	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
2	AFDB:P59047	0.758	0.697	1.702E-82	1200	0.381	0.347	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
3	AFDB:F1MT67	0.753	0.750	5.695E-80	1098	0.367	0.365	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
4	AFDB:Q96MN2	0.642	0.697	1.031E-75	994	0.373	0.410	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
5	AFDB:Q7RTR0	0.639	0.696	2.454E-75	991	0.364	0.402	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
6	AFDB:P59046	0.493	0.503	1.069E-73	1061	0.368	0.379	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
7	AFDB:Q9R1M5	0.763	0.721	5.301E-72	1163	0.332	0.312	Q9R1M5.pdb.gz	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
8	AFDB:E9Q5R7	0.462	0.475	1.859E-70	1054	0.349	0.361	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
9	AFDB:Q9NX02	0.699	0.718	1.249E-68	1062	0.347	0.357	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
10	AFDB:Q96P20	0.275	0.287	2.394E-68	1036	0.353	0.373	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
11	PDB:7pzcA	0.391	0.414	3.891E-54	1010	0.353	0.382	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.376	0.490	1.946E-42	806	0.304	0.412	7lfhA.pdb.gz
13	PDB:6npyA	0.326	0.428	8.000E-37	798	0.290	0.397	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:1a4yA	0.389	0.894	2.195E-27	460	0.134	0.317	1a4yA.pdb.gz
15	PDB:4kxfP	0.377	0.442	5.117E-21	866	0.133	0.167	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
16	PDB:3jblA	0.359	0.414	9.196E-15	909	0.148	0.178	3jblA.pdb.gz
17	PDB:6b5bA	0.352	0.327	1.834E-13	1199	0.152	0.138	6b5bA.pdb.gz
18	PDB:5yudA	0.320	0.292	4.153E-11	1238	0.163	0.144	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:6o60C	0.254	0.642	6.989E-11	389	0.080	0.224	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
20	PDB:6j5wA	0.172	0.217	2.559E-9	816	0.120	0.161	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A523	0.0	588	1035	0.344	0.363	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
2	E9Q5R7	0.0	576	1054	0.339	0.351	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
3	F1MT67	0.0	675	1098	0.366	0.364	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
4	J3KN39	0.0	579	1059	0.349	0.361	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
5	P59046	0.0	663	1061	0.373	0.385	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
6	P59047	0.0	704	1200	0.389	0.354	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
7	Q3UWL9	0.0	595	944	0.328	0.379	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
8	Q647I9	0.0	672	1098	0.365	0.363	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
9	Q66X05	0.0	556	959	0.309	0.352	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
10	Q7RTR0	0.0	659	991	0.346	0.381	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
11	Q86W24	0.0	2251	1093	1.000	1.000	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
12	Q8R4B8	0.0	573	1033	0.335	0.354	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
13	Q96MN2	0.0	702	994	0.370	0.406	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
14	Q96P20	0.0	610	1036	0.353	0.373	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
15	Q9NX02	0.0	575	1062	0.347	0.357	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
16	Q9R1M5	0.0	617	1163	0.341	0.321	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
17	Q8WX94	2.41e-173	536	980	0.317	0.353	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
18	P59045	1.68e-157	496	1033	0.295	0.312	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
19	Q66X01	5.33e-155	489	1004	0.313	0.341	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
20	Q66X22	4.89e-151	478	1003	0.305	0.332	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	94	14.4	AAA domain
2	PF13191 AAA_16	0.11	24.3	AAA ATPase domain
3	PF13245 AAA_19	3.9e+02	12.7	AAA domain
4	PF13401 AAA_22	2.5e+02	13.4	AAA domain
5	PF13481 AAA_25	2.2e+02	12.8	AAA domain
6	PF13604 AAA_30	2.4e+02	12.9	AAA domain
7	PF00514 Arm	1.6e+02	13.7	Armadillo/beta-catenin-like repeat
8	PF01637 ATPase_2	3.1e+02	12.7	ATPase domain predominantly from Archaea
9	PF09848 DUF2075	4.4e+02	11.5	Schlafen group 3, DNA/RNA helicase domain
10	PF05241 EBP	14	17.5	EXPERA (EXPanded EBP superfamily)
11	PF13516 LRR_6	1.5e-15	66.9	Leucine Rich repeat
12	PF05729 NACHT	4e-38	142.4	NACHT domain
13	PF00931 NB-ARC	3.3	18.4	NB-ARC domain
14	PF17776 NLRC4_HD2	2e-23	94.8	NLRC4 helical domain HD2
15	PF17779 NOD2_WH	1.6e-15	68.4	NOD2 winged helix domain
16	PF03266 NTPase_1	3.8e+02	12.3	NTPase
17	PF02758 PYRIN	1.4e-22	90.9	PAAD/DAPIN/Pyrin domain
18	PF02367 TsaE	1.8e+02	13.5	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355361	0.942	Leukocyte surface antigen CD47
2	9606.ENSP00000433138	0.685	Caspase-1
3	9606.ENSP00000254250	0.676	THAP domain-containing protein 1
4	9606.ENSP00000219596	0.643	Pyrin
5	9606.ENSP00000260356	0.603	Thrombospondin-1
6	9606.ENSP00000272452	0.531	Sulfotransferase 1C4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.564	catalytic activity
GO:1901363	0.446	heterocyclic compound binding
GO:0097159	0.437	organic cyclic compound binding
GO:0019899	0.355	enzyme binding
GO:0097367	0.340	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.924	multicellular organismal process
GO:0032502	0.885	developmental process
GO:0009987	0.873	cellular process
GO:0050789	0.869	regulation of biological process
GO:0019222	0.555	regulation of metabolic process
GO:0050896	0.554	response to stimulus
GO:0048518	0.546	positive regulation of biological process
GO:0060255	0.542	regulation of macromolecule metabolic process
GO:0051239	0.538	regulation of multicellular organismal process
GO:0000003	0.519	reproduction
GO:0050794	0.466	regulation of cellular process
GO:0019953	0.432	sexual reproduction
GO:0022414	0.428	reproductive process
GO:0007276	0.407	gamete generation
GO:0042221	0.401	response to chemical
GO:0048522	0.395	positive regulation of cellular process
GO:0001817	0.387	regulation of cytokine production
GO:0080090	0.378	regulation of primary metabolic process
GO:0051171	0.374	regulation of nitrogen compound metabolic process
GO:0051716	0.372	cellular response to stimulus
GO:0010033	0.332	response to organic substance
GO:0051240	0.313	positive regulation of multicellular organismal process
GO:0003006	0.310	developmental process involved in reproduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043226	0.963	organelle
GO:0043229	0.951	intracellular organelle
GO:0043227	0.950	membrane-bounded organelle
GO:0043231	0.932	intracellular membrane-bounded organelle
GO:0012505	0.759	endomembrane system
GO:0071944	0.723	cell periphery
GO:0032991	0.525	protein-containing complex
GO:0061702	0.389	inflammasome complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]