StarFunc result for job id Q86W25

User Input

>input (1043 residues)
MNFSVITCPNGGTNQGLLPYLMALDQYQLEEFKLCLEPQQLMDFWSAPQGHFPRIPWANL
RAADPLNLSFLLDEHFPKGQAWKVVLGIFQTMNLTSLCEKVRAEMKENVQTQELQDPTQE
DLEMLEAAAGNMQTQGCQDPNQEELDELEEETGNVQAQGCQDPNQEEPEMLEEADHRRKY
RENMKAELLETWDNISWPKDHVYIRNTSKDEHEELQRLLDPNRTRAQAQTIVLVGRAGVG
KTTLAMQAMLHWANGVLFQQRFSYVFYLSCHKIRYMKETTFAELISLDWPDFDAPIEEFM
SQPEKLLFIIDGFEEIIISESRSESLDDGSPCTDWYQELPVTKILHSLLKKELVPLATLL
ITIKTWFVRDLKASLVNPCFVQITGFTGDDLRVYFMRHFDDSSEVEKILQQLRKNETLFH
SCSAPMVCWTVCSCLKQPKVRYYDLQSITQTTTSLYAYFFSNLFSTAEVDLADDSWPGQW
RALCSLAIEGLWSMNFTFNKEDTEIEGLEVPFIDSLYEFNILQKINDCGGCTTFTHLSFQ
EFFAAMSFVLEEPREFPPHSTKPQEMKMLLQHVLLDKEAYWTPVVLFFFGLLNKNIAREL
EDTLHCKISPRVMEELLKWGEELGKAESASLQFHILRLFHCLHESQEEDFTKKMLGRIFE
VDLNILEDEELQASSFCLKHCKRLNKLRLSVSSHILERDLEILETSKFDSRMHAWNSICS
TLVTNENLHELDLSNSKLHASSVKGLCLALKNPRCKVQKLTCKSVTPEWVLQDLIIALQG
NSKLTHLNFSSNKLGMTVPLILKALRHSACNLKYLCLEKCNLSAASCQDLALFLTSIQHV
TRLCLGFNRLQDDGIKLLCAALTHPKCALERLELWFCQLAAPACKHLSDALLQNRSLTHL
NLSKNSLRDEGVKFLCEALGRPDGNLQSLNLSGCSFTREGCGELANALSHNHNVKILDLG
ENDLQDDGVKLLCEALKPHRALHTLGLAKCNLTTACCQHLFSVLSSSKSLVNLNLLGNEL
DTDGVKMLCKALKKSTCRLQKLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W24	0.687	0.659	2.020E-70	1093	0.380	0.362	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
2	AFDB:Q7RTR0	0.707	0.742	1.535E-65	991	0.317	0.334	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
3	AFDB:Q96MN2	0.690	0.720	6.869E-63	994	0.328	0.344	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
4	AFDB:P59047	0.699	0.617	2.642E-62	1200	0.322	0.280	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
5	AFDB:F1MT67	0.717	0.683	1.423E-61	1098	0.320	0.304	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
6	AFDB:Q9NX02	0.749	0.736	1.934E-60	1062	0.321	0.315	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
7	AFDB:P59046	0.690	0.680	3.793E-60	1061	0.322	0.317	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
8	AFDB:E9Q5R7	0.618	0.612	3.385E-59	1054	0.313	0.309	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
9	AFDB:Q66X22	0.715	0.741	7.221E-59	1003	0.292	0.304	Q66X22.pdb.gz	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
10	AFDB:Q9R1M5	0.638	0.581	9.295E-59	1163	0.289	0.259	Q9R1M5.pdb.gz	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
11	PDB:7pzcA	0.516	0.529	6.438E-44	1010	0.311	0.321	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.625	0.784	5.080E-36	806	0.267	0.346	7lfhA.pdb.gz
13	PDB:6npyA	0.616	0.780	1.485E-30	798	0.236	0.308	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.376	0.430	1.275E-22	866	0.158	0.191	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:1a4yA	0.339	0.744	1.799E-18	460	0.113	0.257	1a4yA.pdb.gz
16	PDB:3jblA	0.330	0.367	3.366E-15	909	0.160	0.184	3jblA.pdb.gz
17	PDB:6b5bA	0.240	0.218	3.133E-14	1199	0.146	0.127	6b5bA.pdb.gz
18	PDB:5yudA	0.353	0.307	1.499E-9	1238	0.142	0.120	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:6j5wA	0.180	0.221	7.740E-9	816	0.124	0.158	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
20	PDB:6o60C	0.247	0.570	8.073E-9	389	0.081	0.216	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86W24	0.0	625	1093	0.384	0.366	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
2	Q96MN2	6.16e-164	511	994	0.305	0.320	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
3	P59046	6.40e-161	504	1061	0.341	0.336	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
4	J3KN39	1.04e-152	483	1059	0.325	0.320	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
5	Q9NX02	1.46e-152	483	1062	0.318	0.313	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
6	P59047	9.06e-152	484	1200	0.333	0.289	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
7	Q7RTR0	2.66e-149	472	991	0.293	0.309	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
8	F1MT67	2.60e-148	473	1098	0.309	0.293	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
9	Q647I9	6.87e-148	471	1098	0.308	0.292	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
10	Q96P20	1.62e-147	469	1036	0.319	0.321	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
11	Q8R4B8	2.18e-147	468	1033	0.314	0.317	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
12	E9Q5R7	5.20e-145	462	1054	0.324	0.321	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
13	D4A523	5.02e-143	457	1035	0.316	0.319	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
14	Q8WX94	1.15e-134	433	980	0.294	0.313	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
15	Q9R1M5	4.34e-127	417	1163	0.294	0.264	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
16	Q66X22	4.40e-123	403	1003	0.277	0.288	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
17	Q3UWL9	3.14e-122	399	944	0.278	0.307	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
18	P59045	3.63e-120	395	1033	0.261	0.263	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
19	Q66X01	2.29e-119	393	1004	0.271	0.282	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
20	Q66X03	7.91e-114	376	949	0.254	0.279	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	5.7e+02	12.3	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	3.6e+02	12.6	AAA domain
3	PF13191 AAA_16	0.83	21.5	AAA ATPase domain
4	PF13401 AAA_22	29	16.4	AAA domain
5	PF13479 AAA_24	6.3e+02	11.5	AAA domain
6	PF13481 AAA_25	0.14	23.2	AAA domain
7	PF01695 IstB_IS21	3.6e+02	12.0	IstB-like ATP binding protein
8	PF00560 LRR_1	35	16.3	Leucine Rich Repeat
9	PF13516 LRR_6	9.5e-12	55.0	Leucine Rich repeat
10	PF13855 LRR_8	1.4e+02	13.7	Leucine rich repeat
11	PF05729 NACHT	1.7e-29	114.3	NACHT domain
12	PF00931 NB-ARC	3.4	18.3	NB-ARC domain
13	PF17776 NLRC4_HD2	9.5e-23	92.6	NLRC4 helical domain HD2
14	PF17779 NOD2_WH	8.3e-05	34.1	NOD2 winged helix domain
15	PF02758 PYRIN	8.6e-17	72.4	PAAD/DAPIN/Pyrin domain
16	PF03193 RsgA_GTPase	92	14.4	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219596	0.630	Pyrin
2	9606.ENSP00000385090	0.626	NLR family CARD domain-containing protein 4
3	9606.ENSP00000433138	0.605	Caspase-1
4	9606.ENSP00000368109	0.542	Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:1901363	0.921	heterocyclic compound binding
GO:0097159	0.921	organic cyclic compound binding
GO:0097367	0.719	carbohydrate derivative binding
GO:0003676	0.704	nucleic acid binding
GO:0003824	0.643	catalytic activity
GO:0042802	0.603	identical protein binding
GO:0003723	0.353	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.965	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0032501	0.958	multicellular organismal process
GO:0009987	0.876	cellular process
GO:0032502	0.852	developmental process
GO:0048518	0.832	positive regulation of biological process
GO:0019222	0.767	regulation of metabolic process
GO:0060255	0.725	regulation of macromolecule metabolic process
GO:0051239	0.644	regulation of multicellular organismal process
GO:0050794	0.547	regulation of cellular process
GO:0010468	0.510	regulation of gene expression
GO:0050896	0.478	response to stimulus
GO:0010604	0.405	positive regulation of macromolecule metabolic process
GO:0051240	0.399	positive regulation of multicellular organismal process
GO:0080090	0.397	regulation of primary metabolic process
GO:0051171	0.393	regulation of nitrogen compound metabolic process
GO:0008152	0.384	metabolic process
GO:0006952	0.365	defense response
GO:0048522	0.363	positive regulation of cellular process
GO:0051707	0.359	response to other organism
GO:0048856	0.344	anatomical structure development
GO:0071704	0.319	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0032991	0.958	protein-containing complex
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0071944	0.687	cell periphery
GO:0061702	0.607	inflammasome complex
GO:0005634	0.414	nucleus
GO:0031982	0.333	vesicle
GO:0043228	0.315	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]