StarFunc result for job id Q86W26

User Input

>input (655 residues)
MAMAKARKPREALLWALSDLEENDFKKLKFYLRDMTLSEGQPPLARGELEGLIPVDLAEL
LISKYGEKEAVKVVLKGLKVMNLLELVDQLSHICLHDYREVYREHVRCLEEWQEAGVNGR
YNQVLLVAKPSSESPESLACPFPEQELESVTVEALFDSGEKPSLAPSLVVLQGSAGTGKT
TLARKMVLDWATGTLYPGRFDYVFYVSCKEVVLLLESKLEQLLFWCCGDNQAPVTEILRQ
PERLLFILDGFDELQRPFEEKLKKRGLSPKESLLHLLIRRHTLPTCSLLITTRPLALRNL
EPLLKQARHVHILGFSEEERARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVV
CSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRVLRSLCSLAAEG
IQHQRFLFEEAELRKHNLDGPRLAAFLSSNDYQLGLAIKKFYSFRHISFQDFFHAMSYLV
KEDQSRLGKESRREVQRLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPC
LAQDLKHFKEQMESMKHNRTWDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQSQN
LFSVKSSLSHGPKEEQKCPSVHGQKEGKDNIAGTQKEASTGKGRGTEETPKNTYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W26	1.000	1.000	1.076E-100	655	1.000	1.000	Q86W26.pdb.gz	NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens OX=9606 GN=NLRP10 PE=1 SV=1
2	AFDB:Q8CCN1	0.725	0.706	2.528E-63	673	0.589	0.574	Q8CCN1.pdb.gz	NAL10_MOUSE NACHT, LRR and PYD domains-containing protein 10 OS=Mus musculus OX=10090 GN=Nlrp10 PE=1 SV=1
3	AFDB:Q96P20	0.426	0.281	3.462E-38	1036	0.351	0.222	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
4	AFDB:P59046	0.536	0.349	4.542E-38	1061	0.342	0.211	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
5	AFDB:E9Q5R7	0.584	0.373	3.174E-37	1054	0.298	0.185	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
6	AFDB:D4A523	0.469	0.315	1.029E-36	1035	0.342	0.216	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
7	AFDB:P59044	0.477	0.372	2.346E-33	892	0.284	0.209	P59044.pdb.gz	NLRP6_HUMAN NACHT, LRR and PYD domains-containing protein 6 OS=Homo sapiens OX=9606 GN=NLRP6 PE=1 SV=2
8	AFDB:Q63035	0.474	0.371	3.524E-33	881	0.267	0.199	Q63035.pdb.gz	NLRP6_RAT NACHT, LRR and PYD domains-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Nlrp6 PE=1 SV=4
9	AFDB:Q91WS2	0.481	0.381	4.434E-32	869	0.270	0.204	Q91WS2.pdb.gz	NLRP6_MOUSE NACHT, LRR and PYD domains-containing protein 6 OS=Mus musculus OX=10090 GN=Nlrp6 PE=1 SV=3
10	AFDB:Q86W24	0.520	0.329	2.174E-29	1093	0.269	0.161	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
11	PDB:7pzcA	0.561	0.374	3.279E-28	1010	0.328	0.213	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:6npyA	0.481	0.401	2.449E-21	798	0.264	0.217	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
13	PDB:7lfhA	0.540	0.448	6.072E-20	806	0.273	0.222	7lfhA.pdb.gz
14	PDB:4kxfP	0.494	0.382	1.164E-14	866	0.111	0.084	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:6b5bA	0.342	0.209	1.862E-9	1199	0.154	0.084	6b5bA.pdb.gz
16	PDB:3jblA	0.322	0.245	1.559E-8	909	0.128	0.092	3jblA.pdb.gz
17	PDB:3sfzA	0.293	0.181	7.307E-6	1133	0.102	0.059	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
18	PDB:4xgcE	0.182	0.267	7.672E-5	402	0.081	0.132	4xgcE.pdb.gz	Crystal structure of the eukaryotic origin recognition complex.
19	PDB:6fvtM	0.203	0.291	1.811E-4	421	0.087	0.135	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
20	PDB:2qbyB	0.231	0.368	2.075E-4	368	0.076	0.136	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86W26	0.0	1350	655	1.000	1.000	NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens OX=9606 GN=NLRP10 PE=1 SV=1
2	Q8CCN1	0.0	743	673	0.592	0.577	NAL10_MOUSE NACHT, LRR and PYD domains-containing protein 10 OS=Mus musculus OX=10090 GN=Nlrp10 PE=1 SV=1
3	Q96P20	1.69e-106	348	1036	0.344	0.217	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
4	P59046	1.73e-102	337	1061	0.348	0.215	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
5	Q8R4B8	7.79e-101	332	1033	0.350	0.222	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
6	D4A523	1.18e-97	324	1035	0.357	0.226	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
7	E9Q5R7	3.56e-83	285	1054	0.311	0.194	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
8	Q86W24	7.63e-69	245	1093	0.258	0.155	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
9	Q9C000	3.10e-68	244	1473	0.269	0.119	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
10	Q2LKW6	7.64e-61	223	1233	0.226	0.120	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
11	Q0GKD5	1.68e-60	221	1196	0.224	0.123	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
12	P59044	2.23e-60	219	892	0.270	0.198	NLRP6_HUMAN NACHT, LRR and PYD domains-containing protein 6 OS=Homo sapiens OX=9606 GN=NLRP6 PE=1 SV=2
13	Q63035	3.13e-60	218	881	0.285	0.212	NLRP6_RAT NACHT, LRR and PYD domains-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Nlrp6 PE=1 SV=4
14	A1Z198	3.80e-60	220	1177	0.247	0.138	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
15	Q2LKV5	5.33e-60	220	1172	0.223	0.125	NL1B3_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 3 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
16	Q2LKU9	1.24e-59	219	1182	0.247	0.137	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
17	Q96MN2	1.33e-59	218	994	0.227	0.150	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
18	Q2LKV2	2.43e-59	216	906	0.220	0.159	NL1B4_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 4 OS=Mus musculus OX=10090 GN=Nlrp1b PE=2 SV=1
19	D9I2F9	5.06e-59	217	1218	0.231	0.124	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
20	D9I2G3	5.35e-59	217	1218	0.231	0.124	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	61	15.5	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	6.5	18.6	AAA ATPase domain
3	PF13401 AAA_22	1.1e+02	14.5	AAA domain
4	PF13481 AAA_25	0.15	23.1	AAA domain
5	PF13604 AAA_30	1.3e+02	13.7	AAA domain
6	PF13671 AAA_33	3.6e+02	12.7	AAA domain
7	PF12775 AAA_7	1.4e+02	13.4	P-loop containing dynein motor region
8	PF05729 NACHT	7.3e-39	144.8	NACHT domain
9	PF00931 NB-ARC	28	15.3	NB-ARC domain
10	PF17776 NLRC4_HD2	0.07	25.2	NLRC4 helical domain HD2
11	PF17779 NOD2_WH	7.8e-07	40.6	NOD2 winged helix domain
12	PF02562 PhoH	7.2e+02	11.0	PhoH-like protein
13	PF02758 PYRIN	7.5e-16	69.4	PAAD/DAPIN/Pyrin domain
14	PF02367 TsaE	70	14.8	Threonylcarbamoyl adenosine biosynthesis protein TsaE
15	PF06414 Zeta_toxin	4.6e+02	11.6	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327763

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355231	0.611	Beclin-1
2	9606.ENSP00000385090	0.602	NLR family CARD domain-containing protein 4
3	9606.ENSP00000364512	0.590	Glucose-6-phosphatase 2
4	9606.ENSP00000353988	0.557	Olfactory receptor 10A3
5	9606.ENSP00000357158	0.548	Fc receptor-like protein 1
6	9606.ENSP00000247470	0.536	Apoptosis-associated speck-like protein containing a CARD
7	9606.ENSP00000433138	0.505	Caspase-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003924	0.998	GTPase activity
GO:0016887	0.997	ATP hydrolysis activity
GO:0005515	0.995	protein binding
GO:1901363	0.666	heterocyclic compound binding
GO:0097159	0.642	organic cyclic compound binding
GO:0097367	0.465	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0048518	0.994	positive regulation of biological process
GO:0048583	0.991	regulation of response to stimulus
GO:0044419	0.989	biological process involved in interspecies interaction between organisms
GO:0032652	0.983	regulation of interleukin-1 production
GO:0031347	0.980	regulation of defense response
GO:0006950	0.977	response to stress
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0006952	0.970	defense response
GO:0048584	0.967	positive regulation of response to stimulus
GO:0051707	0.958	response to other organism
GO:0002831	0.956	regulation of response to biotic stimulus
GO:0001819	0.952	positive regulation of cytokine production
GO:0032101	0.947	regulation of response to external stimulus
GO:0032732	0.940	positive regulation of interleukin-1 production
GO:0032103	0.915	positive regulation of response to external stimulus
GO:0098542	0.899	defense response to other organism
GO:0050794	0.897	regulation of cellular process
GO:0009617	0.886	response to bacterium
GO:0031349	0.875	positive regulation of defense response
GO:0009987	0.862	cellular process
GO:0042742	0.829	defense response to bacterium
GO:0048522	0.725	positive regulation of cellular process
GO:0002833	0.689	positive regulation of response to biotic stimulus
GO:0051171	0.603	regulation of nitrogen compound metabolic process
GO:0023051	0.557	regulation of signaling
GO:0010646	0.557	regulation of cell communication
GO:0080090	0.534	regulation of primary metabolic process
GO:0048519	0.509	negative regulation of biological process
GO:0032675	0.502	regulation of interleukin-6 production
GO:0032677	0.481	regulation of interleukin-8 production
GO:0032651	0.446	regulation of interleukin-1 beta production
GO:1900424	0.436	regulation of defense response to bacterium
GO:0050778	0.432	positive regulation of immune response
GO:0002376	0.427	immune system process
GO:0009966	0.422	regulation of signal transduction
GO:0051716	0.411	cellular response to stimulus
GO:0065009	0.400	regulation of molecular function
GO:0051173	0.378	positive regulation of nitrogen compound metabolic process
GO:0051246	0.376	regulation of protein metabolic process
GO:0042221	0.370	response to chemical
GO:0031323	0.352	regulation of cellular metabolic process
GO:0052548	0.349	regulation of endopeptidase activity
GO:0050727	0.342	regulation of inflammatory response
GO:2000116	0.337	regulation of cysteine-type endopeptidase activity
GO:0010033	0.335	response to organic substance
GO:1902531	0.333	regulation of intracellular signal transduction
GO:0032755	0.330	positive regulation of interleukin-6 production
GO:0044093	0.316	positive regulation of molecular function
GO:0032757	0.316	positive regulation of interleukin-8 production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.997	membrane
GO:0071944	0.990	cell periphery
GO:0005886	0.979	plasma membrane
GO:0005829	0.955	cytosol
GO:0032991	0.927	protein-containing complex
GO:0019898	0.921	extrinsic component of membrane
GO:0061702	0.792	inflammasome complex
GO:0043226	0.729	organelle
GO:0043231	0.568	intracellular membrane-bounded organelle
GO:0019897	0.510	extrinsic component of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.998	GTP + H2O = GDP + H(+) + phosphate
RHEA:13065	0.997	ATP + H2O = ADP + H(+) + phosphate

[back to server]