StarFunc result for job id Q86W28

User Input

>input (1048 residues)
MSDVNPPSDTPIPFSSSSTHSSHIPPWTFSCYPGSPCENGVMLYMRNVSHEELQRFKQLL
LTELSTGTMPITWDQVETASWAEVVHLLIERFPGRRAWDVTSNIFAIMNCDKMCVVVRRE
INAILPTLEPEDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQ
GVHRHEEYLPCLLLPKRPQGRQPKTVAIQGAPGIGKTILAKKVMFEWARNKFYAHKRWCA
FYFHCQEVNQTTDQSFSELIEQKWPGSQDLVSKIMSKPDQLLLLLDGFEELTSTLIDRLE
DLSEDWRQKLPGSVLLSSLLSKTMLPEATLLIMIRFTSWQTCKPLLKCPSLVTLPGFNTM
EKIKYFQMYFGHTEEGDQVLSFAMENTILFSMCRVPVVCWMVCSGLKQQMERGNNLTQSC
PNATSVFVRYISSLFPTRAENFSRKIHQAQLEGLCHLAADSMWHRKWVLGKEDLEEAKLD
QTGVTAFLGMSILRRIAGEEDHYVFTLVTFQEFFAALFYVLCFPQRLKNFHVLSHVNIQR
LIASPRGSKSYLSHMGLFLFGFLNEACASAVEQSFQCKVSFGNKRKLLKVIPLLHKCDPP
SPGSGVPQLFYCLHEIREEAFVSQALNDYHKVVLRIGNNKEVQVSAFCLKRCQYLHEVEL
TVTLNFMNVWKLSSSSHPGSEAPESNGLHRWWQDLCSVFATNDKLEVLTMTNSVLGPPFL
KALAAALRHPQCKLQKLLLRRVNSTMLNQDLIGVLTGNQHLRYLEIQHVEVESKAVKLLC
RVLRSPRCRLQCLRLEDCLATPRIWTDLGNNLQGNGHLKTLILRKNSLENCGAYYLSVAQ
LERLSIENCNLTQLTCESLASCLRQSKMLTHLSLAENALKDEGAKHIWNALPHLRCPLQR
LVLRKCDLTFNCCQDMISALCKNKTLKSLDLSFNSLKDDGVILLCEALKNPDCTLQILEL
ENCLFTSICCQAMASMLRKNQHLRHLDLSKNAIGVYGILTLCEAFSSQKKREEVIFCIPA
WTRITSFSPTPHPPDFTGKSDCLSQINP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W24	0.711	0.685	1.712E-65	1093	0.346	0.332	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
2	AFDB:Q7RTR0	0.644	0.676	3.737E-59	991	0.294	0.311	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
3	AFDB:Q96MN2	0.638	0.668	7.420E-58	994	0.298	0.314	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
4	AFDB:P59047	0.749	0.659	4.989E-57	1200	0.290	0.253	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
5	AFDB:F1MT67	0.740	0.708	7.368E-57	1098	0.286	0.273	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
6	AFDB:Q9NX02	0.696	0.688	2.256E-55	1062	0.285	0.282	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
7	AFDB:D4A523	0.534	0.540	4.108E-54	1035	0.297	0.300	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
8	AFDB:Q96P20	0.434	0.438	2.762E-53	1036	0.298	0.301	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
9	AFDB:Q9R1M5	0.696	0.632	1.631E-52	1163	0.252	0.227	Q9R1M5.pdb.gz	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
10	AFDB:P59046	0.663	0.655	1.939E-52	1061	0.310	0.306	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
11	PDB:7pzcA	0.641	0.662	2.928E-41	1010	0.286	0.297	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.619	0.782	9.786E-34	806	0.254	0.330	7lfhA.pdb.gz
13	PDB:6npyA	0.516	0.649	8.295E-29	798	0.248	0.326	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.331	0.381	7.674E-18	866	0.121	0.147	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:1a4yA	0.322	0.696	2.250E-16	460	0.109	0.248	1a4yA.pdb.gz
16	PDB:6b5bA	0.212	0.188	1.558E-13	1199	0.146	0.128	6b5bA.pdb.gz
17	PDB:3jblA	0.255	0.283	7.681E-12	909	0.119	0.138	3jblA.pdb.gz
18	PDB:5yudA	0.304	0.268	1.712E-8	1238	0.136	0.116	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:6o60C	0.221	0.504	2.511E-7	389	0.079	0.213	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
20	PDB:2p1nB	0.187	0.301	4.604E-7	571	0.073	0.135	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86W24	0.0	619	1093	0.344	0.330	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
2	Q7RTR0	8.97e-155	486	991	0.294	0.311	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
3	Q96MN2	5.77e-148	469	994	0.299	0.315	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
4	P59046	1.62e-141	454	1061	0.322	0.318	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
5	D4A523	4.24e-136	438	1035	0.308	0.312	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
6	Q8WX94	1.15e-135	436	980	0.281	0.300	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
7	Q647I9	2.71e-135	438	1098	0.295	0.281	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
8	F1MT67	1.67e-134	436	1098	0.295	0.281	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
9	Q8R4B8	5.13e-133	430	1033	0.299	0.303	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
10	J3KN39	1.60e-131	427	1059	0.266	0.263	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
11	Q9NX02	2.28e-131	426	1062	0.266	0.263	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
12	Q96P20	2.01e-130	423	1036	0.272	0.275	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
13	P59047	2.68e-125	413	1200	0.268	0.234	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
14	Q3UWL9	8.83e-123	400	944	0.269	0.299	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
15	Q9R1M5	9.96e-123	405	1163	0.265	0.239	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
16	E9Q5R7	1.05e-122	403	1054	0.298	0.296	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
17	Q66X05	5.42e-106	355	959	0.259	0.283	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
18	Q66X22	2.20e-103	349	1003	0.259	0.270	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
19	Q66X03	1.11e-101	343	949	0.257	0.283	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
20	Q66X01	1.62e-97	333	1004	0.266	0.278	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.2e+02	14.5	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.43	22.4	AAA ATPase domain
3	PF13401 AAA_22	2.2e+02	13.5	AAA domain
4	PF13481 AAA_25	4.7e+02	11.7	AAA domain
5	PF12799 LRR_4	2.4	20.0	Leucine Rich repeats (2 copies)
6	PF13516 LRR_6	6.9e-09	46.1	Leucine Rich repeat
7	PF13855 LRR_8	0.94	20.6	Leucine rich repeat
8	PF05729 NACHT	1e-27	108.6	NACHT domain
9	PF00931 NB-ARC	25	15.5	NB-ARC domain
10	PF17776 NLRC4_HD2	5.2e-17	74.1	NLRC4 helical domain HD2
11	PF17779 NOD2_WH	3e-10	51.5	NOD2 winged helix domain
12	PF02758 PYRIN	7.1e-14	63.0	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291971

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308082	0.694	Olfactory receptor 10P1
2	9606.ENSP00000219596	0.638	Pyrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:1901363	0.695	heterocyclic compound binding
GO:0097159	0.630	organic cyclic compound binding
GO:0060089	0.433	molecular transducer activity
GO:0038023	0.421	signaling receptor activity
GO:0003676	0.346	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0009987	0.976	cellular process
GO:0048518	0.958	positive regulation of biological process
GO:0060255	0.897	regulation of macromolecule metabolic process
GO:0050794	0.865	regulation of cellular process
GO:0032501	0.846	multicellular organismal process
GO:0051171	0.837	regulation of nitrogen compound metabolic process
GO:0080090	0.831	regulation of primary metabolic process
GO:0065009	0.829	regulation of molecular function
GO:0050896	0.792	response to stimulus
GO:0010468	0.783	regulation of gene expression
GO:0030162	0.674	regulation of proteolysis
GO:0051239	0.652	regulation of multicellular organismal process
GO:0051336	0.645	regulation of hydrolase activity
GO:0052547	0.624	regulation of peptidase activity
GO:0052548	0.575	regulation of endopeptidase activity
GO:0048522	0.569	positive regulation of cellular process
GO:2000116	0.560	regulation of cysteine-type endopeptidase activity
GO:0051707	0.557	response to other organism
GO:0001817	0.527	regulation of cytokine production
GO:0044093	0.502	positive regulation of molecular function
GO:0010604	0.479	positive regulation of macromolecule metabolic process
GO:0051240	0.471	positive regulation of multicellular organismal process
GO:0001819	0.444	positive regulation of cytokine production
GO:0045862	0.439	positive regulation of proteolysis
GO:0098542	0.428	defense response to other organism
GO:0043281	0.425	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048583	0.418	regulation of response to stimulus
GO:2001056	0.410	positive regulation of cysteine-type endopeptidase activity
GO:0032652	0.409	regulation of interleukin-1 production
GO:0010033	0.367	response to organic substance
GO:0032732	0.362	positive regulation of interleukin-1 production
GO:0032731	0.337	positive regulation of interleukin-1 beta production
GO:0008152	0.334	metabolic process
GO:0031323	0.316	regulation of cellular metabolic process
GO:0071704	0.301	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.992	cytosol
GO:0043226	0.923	organelle
GO:0043229	0.901	intracellular organelle
GO:0043231	0.821	intracellular membrane-bounded organelle
GO:0071944	0.343	cell periphery
GO:0005634	0.329	nucleus
GO:0032991	0.306	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]