StarFunc result for job id Q86W50

User Input

>input (562 residues)
MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLL
REDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLL
GATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDF
CMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTGGITEIMAEGGELEFVKRIIHDSLQLKK
RLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFYDDVTVPSPPS
KRRKLEKPRKPITFVVLASVMKELSLKASPLRSETAEGIVVVTTWIEKILTDLKVQHKRV
PCGKEEVSLFLTAIENSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQ
ELARGPQERTPCGPALREGEAAAVEGPCPSQESLSQEENPEPTEDERSEEKGGVEVLESC
QGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVEGQN
RDLMNQLCTYIRNQIFRLVAVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W50	1.000	1.000	0.000	562	1.000	1.000	Q86W50.pdb.gz	MET16_HUMAN RNA N6-adenosine-methyltransferase METTL16 OS=Homo sapiens OX=9606 GN=METTL16 PE=1 SV=2
2	AFDB:Q9CQG2	0.849	0.862	1.763E-98	553	0.879	0.893	Q9CQG2.pdb.gz	MET16_MOUSE RNA N6-adenosine-methyltransferase METTL16 OS=Mus musculus OX=10090 GN=Mettl16 PE=1 SV=1
3	AFDB:Q09357	0.493	0.577	1.690E-39	479	0.286	0.336	Q09357.pdb.gz	MET16_CAEEL U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=mett-10 PE=1 SV=2
4	AFDB:O42662	0.428	0.615	2.979E-30	385	0.201	0.294	O42662.pdb.gz	MTL16_SCHPO U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27D7.08c PE=1 SV=2
5	AFDB:P75782	0.465	0.822	1.639E-24	308	0.164	0.299	P75782.pdb.gz	RLMF_ECOLI Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain K12) OX=83333 GN=rlmF PE=1 SV=2
6	PDB:2b3tA	0.305	0.566	4.461E-9	276	0.073	0.149	2b3tA.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
7	PDB:1x19A	0.231	0.346	1.298E-6	350	0.078	0.126	1x19A.pdb.gz
8	PDB:6kmsC	0.258	0.609	1.844E-6	210	0.048	0.129	6kmsC.pdb.gz	Structural insight into human N6amt1-Trm112 complex functioning as a protein methyltransferase.
9	PDB:3bt7A	0.235	0.345	2.471E-6	369	0.046	0.070	3bt7A.pdb.gz	Structure of a TrmA-RNA complex: A consensus RNA fold contributes to substrate selectivity and catalysis in m5U methyltransferases.
10	PDB:4qvgC	0.232	0.351	3.310E-6	349	0.055	0.089	4qvgC.pdb.gz
11	PDB:6jclG	0.236	0.525	3.945E-6	219	0.066	0.169	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
12	PDB:3v97B	0.224	0.199	4.984E-6	641	0.062	0.055	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
13	PDB:7ajuJL	0.228	0.417	1.006E-5	283	0.071	0.141	7ajuJL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:1jsxA	0.188	0.467	1.271E-5	193	0.052	0.150	1jsxA.pdb.gz
15	PDB:3gwzA	0.214	0.327	1.428E-5	339	0.046	0.077	3gwzA.pdb.gz	Structural characterization of the mitomycin 7-O-methyltransferase.
16	AFDB:Q4AE70	0.150	0.133	1.832E-2	651	0.116	0.100	Q4AE70.pdb.gz	CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus OX=10116 GN=Carm1 PE=1 SV=1
17	AFDB:Q96RS0	0.276	0.191	2.602E-2	853	0.069	0.046	Q96RS0.pdb.gz	TGS1_HUMAN Trimethylguanosine synthase OS=Homo sapiens OX=9606 GN=TGS1 PE=1 SV=3
18	AFDB:P21513	0.108	0.063	7.033E-2	1061	0.093	0.049	P21513.pdb.gz	RNE_ECOLI Ribonuclease E OS=Escherichia coli (strain K12) OX=83333 GN=rne PE=1 SV=6
19	AFDB:Q7SYM7	0.072	0.080	1.338E-1	493	0.084	0.095	Q7SYM7.pdb.gz
20	AFDB:M0QZQ2	0.164	0.127	1.793E-1	796	0.107	0.075	M0QZQ2.pdb.gz	M0QZQ2_HUMAN Mediator of RNA polymerase II transcription subunit 25 OS=Homo sapiens OX=9606 GN=MED25 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86W50	0.0	1161	562	1.000	1.000	MET16_HUMAN RNA N6-adenosine-methyltransferase METTL16 OS=Homo sapiens OX=9606 GN=METTL16 PE=1 SV=2
2	Q9CQG2	0.0	1004	553	0.879	0.893	MET16_MOUSE RNA N6-adenosine-methyltransferase METTL16 OS=Mus musculus OX=10090 GN=Mettl16 PE=1 SV=1
3	Q09357	6.27e-72	239	479	0.253	0.296	MET16_CAEEL U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=mett-10 PE=1 SV=2
4	F4IGH3	1.77e-62	216	513	0.238	0.261	F4IGH3_ARATH U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=FIO1 PE=1 SV=1
5	P0DPA9	5.42e-61	206	309	0.203	0.369	PSIM_PSICU Psilocybin synthase OS=Psilocybe cubensis OX=181762 GN=psiM PE=1 SV=1
6	O42662	5.65e-51	181	385	0.176	0.257	MTL16_SCHPO U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27D7.08c PE=1 SV=2
7	P75782	1.45e-39	148	308	0.160	0.292	RLMF_ECOLI Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain K12) OX=83333 GN=rlmF PE=1 SV=2
8	Q8IDX6	0.47	36.2	3130	0.050	0.009	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
9	K9NBS6	0.87	34.7	477	0.039	0.046	AAM_RHOER Acylamidase OS=Rhodococcus erythropolis OX=1833 GN=aam PE=1 SV=1
10	A7E1Z1	2.5	32.7	235	0.069	0.166	TM215_MOUSE Transmembrane protein 215 OS=Mus musculus OX=10090 GN=Tmem215 PE=2 SV=1
11	Q8N859	5.9	32.0	443	0.034	0.043	ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens OX=9606 GN=ZNF713 PE=2 SV=2
12	Q54JS9	6.5	32.0	317	0.036	0.063	Q54JS9_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287889 PE=4 SV=1
13	P19970	6.8	32.0	989	0.048	0.027	FRQ_NEUCR Frequency clock protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=frq PE=1 SV=3
14	Q9EQG3	9.2	31.6	652	0.043	0.037	SCEL_MOUSE Sciellin OS=Mus musculus OX=10090 GN=Scel PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05971 Methyltransf_10	1.6e-133	456.3	RNA methyltransferase
2	PF05175 MTS	0.07	24.2	Methyltransferase small domain
3	PF06325 PrmA	2.4	19.1	Ribosomal protein L11 methyltransferase (PrmA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263092

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298717	0.858	N6-adenosine-methyltransferase catalytic subunit
2	9606.ENSP00000303147	0.821	S-adenosylmethionine synthase isoform type-2
3	9606.ENSP00000485396	0.808	Metastasis-associated lung adenocarcinoma transcript 1
4	9606.ENSP00000373474	0.806	N6-adenosine-methyltransferase non-catalytic subunit
5	9606.ENSP00000308546	0.802	7SK snRNA methylphosphate capping enzyme
6	9606.ENSP00000297591	0.800	Protein virilizer homolog
7	9606.ENSP00000351141	0.792	Pre-mRNA-splicing regulator WTAP
8	9606.ENSP00000358799	0.761	Putative RNA-binding protein 15
9	9606.ENSP00000480056	0.747	Methyltransferase-like protein 8
10	9606.ENSP00000454545	0.736	Putative RNA-binding protein 15B
11	9606.ENSP00000350874	0.730	Methyltransferase-like protein 9
12	9606.ENSP00000248306	0.723	Methyltransferase-like protein 25
13	9606.ENSP00000314441	0.723	tRNA (guanine-N(7)-)-methyltransferase
14	9606.ENSP00000344071	0.717	Methyltransferase-like protein 24
15	9606.ENSP00000382091	0.716	RNA demethylase ALKBH5
16	9606.ENSP00000282007	0.713	Zinc finger CCCH domain-containing protein 13
17	9606.ENSP00000458986	0.701	Clustered mitochondria protein homolog
18	9606.ENSP00000339245	0.698	YTH domain-containing protein 1
19	9606.ENSP00000483489	0.684	N-terminal Xaa-Pro-Lys N-methyltransferase 1
20	9606.ENSP00000359364	0.679	YTH domain-containing family protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0001734	1.000	mRNA (N6-adenosine)-methyltransferase activity
GO:0017069	0.969	snRNA binding
GO:0035613	0.960	RNA stem-loop binding
GO:0017070	0.955	U6 snRNA binding
GO:0120048	0.874	U6 snRNA (adenine-(43)-N(6))-methyltransferase activity
GO:0005515	0.648	protein binding
GO:0030629	0.567	U6 snRNA 3'-end binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0065007	0.995	biological regulation
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0009896	0.991	positive regulation of catabolic process
GO:0061013	0.991	regulation of mRNA catabolic process
GO:0043487	0.991	regulation of RNA stability
GO:1903313	0.990	positive regulation of mRNA metabolic process
GO:0001510	0.989	RNA methylation
GO:0043488	0.983	regulation of mRNA stability
GO:0016556	0.982	mRNA modification
GO:0061014	0.977	positive regulation of mRNA catabolic process
GO:0046500	0.976	S-adenosylmethionine metabolic process
GO:0048519	0.956	negative regulation of biological process
GO:0044249	0.949	cellular biosynthetic process
GO:0034660	0.749	ncRNA metabolic process
GO:0010556	0.510	regulation of macromolecule biosynthetic process
GO:0031326	0.510	regulation of cellular biosynthetic process
GO:0034248	0.502	regulation of amide metabolic process
GO:0051246	0.499	regulation of protein metabolic process
GO:0006417	0.431	regulation of translation
GO:0048024	0.397	regulation of mRNA splicing, via spliceosome
GO:1901576	0.391	organic substance biosynthetic process
GO:0080009	0.384	mRNA methylation
GO:0044272	0.352	sulfur compound biosynthetic process
GO:0010467	0.350	gene expression
GO:0009892	0.305	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.957	nuclear lumen
GO:0005654	0.925	nucleoplasm
GO:0005829	0.723	cytosol
GO:0032991	0.331	protein-containing complex
GO:0043232	0.303	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]