StarFunc result for job id Q86W92

User Input

>input (1011 residues)
MMSDASDMLAAALEQMDGIIAGSKALEYSNGIFDCQSPTSPFMGSLRALHLVEDLRGLLE
MMETDEKEGLRCQIPDSTAETLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQV
SVLTDQVEAQGEKIRDLEFCLEEHREKVNATEEMLQQELLSRTSLETQKLDLMAEISNLK
LKLTAVEKDRLDYEDKFRDTEGLIQEINDLRLKVSEMDSERLQYEKKLKSTKSLMAKLSS
MKIKVGQMQYEKQRMEQKWESLKDELASLKEQLEEKESEVKRLQEKLVCKMKGEGVEIVD
RDIEVQKMKKAVESLMAANEEKDRKIEDLRQCLNRYKKMQDTVVLAQGKDGEYEELLNSS
SISSLLDAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSME
TSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKE
TIQKTSEDRAPAESRPFGTLPPRPPGQDTSMDDNPFGTRKVRSSFGRGFFKIKSNKRTAS
APNLAETEKETAEHLDLAGASSRPKDSQRNSPFQIPPPSPDSKKKSRGIMKLFGKLRRSQ
STTFNPDDMSEPEFKRGGTRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQG
LGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHGKLD
FNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLR
INNFEPNCLRRRPSDENTIAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVL
EPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKV
KPKKLAFSNFGNLRKKKQEDGEEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLE
QMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAARSPSASITDEDSNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W92	1.000	1.000	0.000	1011	1.000	1.000	Q86W92.pdb.gz	LIPB1_HUMAN Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2
2	AFDB:G3V9H6	0.305	0.350	5.103E-60	876	0.435	0.502	G3V9H6.pdb.gz	G3V9H6_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=2
3	AFDB:O75335	0.216	0.185	3.848E-23	1185	0.214	0.182	O75335.pdb.gz	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3
4	AFDB:O75334	0.227	0.185	9.991E-23	1257	0.209	0.168	O75334.pdb.gz	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
5	AFDB:F4IIV5	0.073	0.061	7.251E-5	1297	0.132	0.103	F4IIV5.pdb.gz	F4IIV5_ARATH Maternal effect embryo arrest 22 OS=Arabidopsis thaliana OX=3702 GN=MEE22 PE=1 SV=1
6	AFDB:A0A166B1A6	0.079	0.073	8.430E-5	1119	0.113	0.102	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
7	AFDB:Q9SAF6	0.094	0.085	1.790E-4	1128	0.114	0.102	Q9SAF6.pdb.gz	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
8	AFDB:M9MRX0	0.122	0.124	5.682E-4	989	0.115	0.117	M9MRX0.pdb.gz	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
9	AFDB:Q6UVJ0	0.115	0.168	7.304E-4	657	0.077	0.119	Q6UVJ0.pdb.gz	SAS6_HUMAN Spindle assembly abnormal protein 6 homolog OS=Homo sapiens OX=9606 GN=SASS6 PE=1 SV=1
10	AFDB:Q9P219	0.088	0.050	1.334E-3	2028	0.108	0.054	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
11	PDB:7anwA	0.079	0.105	5.611E-3	645	0.038	0.059	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
12	PDB:6wpkA	0.066	0.119	1.327E-1	547	0.029	0.053	6wpkA.pdb.gz
13	PDB:7cm7A	0.073	0.107	2.193E-1	620	0.045	0.074	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
14	PDB:1kw2A	0.072	0.113	1.478	455	0.045	0.101	1kw2A.pdb.gz
15	PDB:3javA	0.062	0.037	1.554	2327	0.097	0.042	3javA.pdb.gz
16	PDB:3bs5A	0.056	0.520	1.807	86	0.011	0.128	3bs5A.pdb.gz
17	PDB:5tbyA	0.041	0.044	4.692	954	0.031	0.032	5tbyA.pdb.gz
18	PDB:5z56L	0.059	0.153	4.933	342	0.029	0.085	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
19	PDB:2mxxA	0.034	0.143	5.736	179	0.026	0.145	2mxxA.pdb.gz
20	PDB:7dcoL	0.071	0.149	5.736	435	0.024	0.055	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZVX1	0.0	766	981	0.468	0.482	A0A8I5ZVX1_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
2	F5GZP6	0.0	1524	744	0.733	0.996	F5GZP6_HUMAN PPFIA binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=1
3	Q86W92	0.0	2081	1011	1.000	1.000	LIPB1_HUMAN Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2
4	A0A8I6ALR5	3.15e-170	523	909	0.247	0.275	A0A8I6ALR5_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
5	A0A0G2K383	2.01e-169	523	970	0.247	0.258	A0A0G2K383_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
6	H0YFE4	9.37e-167	490	242	0.238	0.996	H0YFE4_HUMAN PPFIA binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=1
7	G3V9H6	1.83e-160	494	799	0.232	0.294	G3V9H6_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=2
8	Q8ND30	4.83e-154	480	876	0.224	0.258	LIPB2_HUMAN Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 PE=1 SV=3
9	H0YGH8	5.93e-134	403	205	0.200	0.985	H0YGH8_HUMAN PPFIA binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=1
10	Q9VU88	1.99e-89	302	680	0.168	0.250	Q9VU88_DROME AT31531p OS=Drosophila melanogaster OX=7227 GN=Liprin-beta PE=2 SV=1
11	Q94071	2.56e-82	290	1004	0.250	0.252	LIPB_CAEEL Liprin-beta homolog OS=Caenorhabditis elegans OX=6239 GN=hlb-1 PE=2 SV=5
12	A8DYM1	1.49e-45	179	852	0.099	0.117	A8DYM1_DROME Liprin-gamma, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
13	A0A0B4LG34	3.28e-45	179	1082	0.099	0.092	A0A0B4LG34_DROME Liprin-gamma, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
14	A8DYM0	5.43e-45	179	1152	0.099	0.087	A8DYM0_DROME Liprin-gamma, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
15	Q9W263	6.22e-45	178	1023	0.099	0.098	Q9W263_DROME Liprin-gamma, isoform A OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=2
16	Q674X7	1.52e-41	166	775	0.096	0.125	KAZRN_HUMAN Kazrin OS=Homo sapiens OX=9606 GN=KAZN PE=1 SV=2
17	A0A1B0GWK2	1.75e-41	167	863	0.096	0.112	A0A1B0GWK2_HUMAN Kazrin, periplakin interacting protein OS=Homo sapiens OX=9606 GN=KAZN PE=1 SV=1
18	M9PCD4	4.26e-34	144	1214	0.088	0.073	M9PCD4_DROME Liprin-alpha, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
19	Q9VM93	5.40e-34	144	1201	0.089	0.075	Q9VM93_DROME LD33094p OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=2
20	M9PC73	5.46e-34	144	1158	0.089	0.078	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19220 Crescentin	20	15.7	Crescentin protein
2	PF01519 DUF16	1.7	20.5	Protein of unknown function DUF16
3	PF09486 HrpB7	6.9e+02	12.0	Bacterial type III secretion protein (HrpB7)
4	PF00536 SAM_1	1.1e-35	133.2	SAM domain (Sterile alpha motif)
5	PF07647 SAM_2	3.7e-29	112.0	SAM domain (Sterile alpha motif)
6	PF02198 SAM_PNT	1.1e+02	14.2	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314724

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357705	0.989	S100 calcium binding protein A4
2	9606.ENSP00000353030	0.929	Receptor-type tyrosine-protein phosphatase F
3	9606.ENSP00000450337	0.900	Liprin-alpha-2
4	9606.ENSP00000349932	0.879	Receptor-type tyrosine-protein phosphatase S
5	9606.ENSP00000370593	0.866	Receptor-type tyrosine-protein phosphatase delta
6	9606.ENSP00000253925	0.841	Liprin-alpha-1
7	9606.ENSP00000272198	0.838	Liprin-alpha-4
8	9606.ENSP00000335614	0.827	Liprin-alpha-3
9	9606.ENSP00000354878	0.817	Kinesin-like protein KIF21A
10	9606.ENSP00000477725	0.749	KN motif and ankyrin repeat domain-containing protein 1
11	9606.ENSP00000280758	0.713	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
12	9606.ENSP00000011898	0.693	Tetraspanin-9
13	9606.ENSP00000342322	0.692	Transmembrane 7 superfamily member 3
14	9606.ENSP00000379287	0.672	14-3-3 protein zeta/delta
15	9606.ENSP00000468002	0.671	KN motif and ankyrin repeat domain-containing protein 2
16	9606.ENSP00000468263	0.643	ELKS/Rab6-interacting/CAST family member 1
17	9606.ENSP00000388996	0.601	AP-1 complex subunit mu-1
18	9606.ENSP00000301015	0.592	Piezo-type mechanosensitive ion channel component 1
19	9606.ENSP00000373539	0.580	Stabilin-2
20	9606.ENSP00000357869	0.570	Phosphatidylinositol 4-kinase beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0007155	0.929	cell adhesion
GO:0065007	0.845	biological regulation
GO:0050789	0.828	regulation of biological process
GO:0050794	0.818	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005737	0.983	cytoplasm
GO:0005829	0.968	cytosol
GO:0030054	0.923	cell junction
GO:0043226	0.735	organelle
GO:0043227	0.679	membrane-bounded organelle
GO:0043231	0.662	intracellular membrane-bounded organelle
GO:0030055	0.451	cell-substrate junction
GO:0005925	0.432	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]