StarFunc result for job id Q86WA6

User Input

>input (291 residues)
MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGD
HAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKD
AVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIR
DVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVH
GEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WA6	1.000	1.000	7.548E-63	291	1.000	1.000	Q86WA6.pdb.gz	BPHL_HUMAN Valacyclovir hydrolase OS=Homo sapiens OX=9606 GN=BPHL PE=1 SV=1
2	PDB:2ocgA	0.872	0.999	8.520E-56	254	0.873	1.000	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
3	AFDB:Q8R164	0.886	0.886	2.382E-55	291	0.818	0.818	Q8R164.pdb.gz	BPHL_MOUSE Valacyclovir hydrolase OS=Mus musculus OX=10090 GN=Bphl PE=1 SV=1
4	AFDB:Q9VD00	0.855	0.894	1.255E-34	278	0.399	0.417	Q9VD00.pdb.gz	Q9VD00_DROME FI07666p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5377 PE=1 SV=1
5	AFDB:P77044	0.684	0.691	1.394E-16	288	0.216	0.219	P77044.pdb.gz	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
6	AFDB:Q9AQM4	0.725	0.728	1.779E-16	290	0.206	0.207	Q9AQM4.pdb.gz	CARC_PSERE 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase OS=Pseudomonas resinovorans OX=53412 GN=carC PE=1 SV=1
7	AFDB:O07732	0.694	0.455	8.693E-16	462	0.172	0.108	O07732.pdb.gz	LIPJ_MYCTU Bifunctional lipase/adenylate cyclase LipJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipJ PE=1 SV=1
8	PDB:1u2eA	0.674	0.685	9.326E-16	286	0.220	0.224	1u2eA.pdb.gz
9	AFDB:Q988D4	0.676	0.705	1.179E-15	278	0.189	0.198	Q988D4.pdb.gz	AAMHY_RHILO 2-(acetamidomethylene)succinate hydrolase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=mlr6787 PE=1 SV=1
10	PDB:5jzsB	0.691	0.706	1.190E-15	284	0.230	0.236	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
11	AFDB:P9WNH5	0.713	0.713	1.333E-15	291	0.241	0.241	P9WNH5.pdb.gz	HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaD PE=1 SV=1
12	AFDB:Q54T91	0.674	0.623	1.505E-15	317	0.175	0.161	Q54T91.pdb.gz	Q54T91_DICDI AB hydrolase-1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281917 PE=4 SV=1
13	AFDB:Q582C7	0.654	0.614	2.308E-15	312	0.213	0.199	Q582C7.pdb.gz	Q582C7_TRYB2 Hydrolase, alpha/beta fold family, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.470 PE=4 SV=1
14	PDB:3e3aB	0.664	0.700	6.985E-15	275	0.131	0.138	3e3aB.pdb.gz
15	PDB:2vavB	0.621	0.524	2.515E-14	350	0.182	0.151	2vavB.pdb.gz	The last step in cephalosporin C formation revealed: crystal structures of deacetylcephalosporin C acetyltransferase from Acremonium chrysogenum in complexes with reaction intermediates.
16	PDB:3kxpA	0.661	0.714	1.088E-13	268	0.203	0.220	3kxpA.pdb.gz
17	PDB:1q0rA	0.643	0.631	3.263E-13	297	0.172	0.168	1q0rA.pdb.gz	Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
18	PDB:4g8bA	0.645	0.674	3.263E-13	277	0.199	0.209	4g8bA.pdb.gz	High-resolution structures of AidH complexes provide insights into a novel catalytic mechanism for N-acyl homoserine lactonase
19	PDB:4htaA	0.584	0.623	7.212E-13	271	0.186	0.199	4htaA.pdb.gz
20	PDB:3afiB	0.653	0.631	1.411E-12	302	0.165	0.159	3afiB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86WA6	0.0	600	291	1.000	1.000	BPHL_HUMAN Valacyclovir hydrolase OS=Homo sapiens OX=9606 GN=BPHL PE=1 SV=1
2	Q8R164	0.0	502	291	0.814	0.814	BPHL_MOUSE Valacyclovir hydrolase OS=Mus musculus OX=10090 GN=Bphl PE=1 SV=1
3	Q9VD00	4.71e-79	243	278	0.395	0.414	Q9VD00_DROME FI07666p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5377 PE=1 SV=1
4	P9WNH5	5.70e-12	67.0	291	0.306	0.306	HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaD PE=1 SV=1
5	Q9K197	1.80e-10	62.4	258	0.186	0.209	BIOH_NEIMB Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=bioH PE=3 SV=2
6	P77044	3.18e-09	58.9	288	0.237	0.240	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
7	Q8IUS5	5.86e-07	52.4	362	0.134	0.108	EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens OX=9606 GN=EPHX4 PE=1 SV=2
8	Q9AQM4	7.80e-07	52.0	290	0.206	0.207	CARC_PSERE 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase OS=Pseudomonas resinovorans OX=53412 GN=carC PE=1 SV=1
9	Q10J20	1.04e-06	51.2	271	0.216	0.232	D14L_ORYSJ Probable esterase D14L OS=Oryza sativa subsp. japonica OX=39947 GN=D14L PE=1 SV=1
10	D2J2T6	2.39e-06	50.1	271	0.227	0.244	D2J2T6_9HYPH Alpha/beta hydrolase fold protein OS=Ochrobactrum sp. T63 OX=680275 GN=aidH PE=1 SV=1
11	Q988D4	2.67e-06	50.1	278	0.141	0.147	AAMHY_RHILO 2-(acetamidomethylene)succinate hydrolase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=mlr6787 PE=1 SV=1
12	P9WNH3	5.34e-06	49.7	341	0.244	0.208	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
13	Q54T91	1.97e-05	47.8	317	0.110	0.101	Q54T91_DICDI AB hydrolase-1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281917 PE=4 SV=1
14	O07732	2.17e-05	47.8	462	0.189	0.119	LIPJ_MYCTU Bifunctional lipase/adenylate cyclase LipJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipJ PE=1 SV=1
15	P75895	2.84e-05	47.0	266	0.192	0.211	RUTD_ECOLI Putative carbamate hydrolase RutD OS=Escherichia coli (strain K12) OX=83333 GN=rutD PE=1 SV=1
16	Q9H6B9	6.22e-05	46.2	360	0.117	0.094	EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens OX=9606 GN=EPHX3 PE=1 SV=1
17	Q582C7	2.91e-04	43.9	312	0.151	0.141	Q582C7_TRYB2 Hydrolase, alpha/beta fold family, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.470 PE=4 SV=1
18	G5EBI4	3.04e-04	44.3	404	0.117	0.084	CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=ceeh-1 PE=1 SV=1
19	Q96I13	5.67e-04	43.5	439	0.175	0.116	ABHD8_HUMAN Protein ABHD8 OS=Homo sapiens OX=9606 GN=ABHD8 PE=1 SV=1
20	Q9ZUN7	8.90e-04	42.7	332	0.137	0.120	Q9ZUN7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g19550 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	7.8e-24	96.3	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	7.5	17.7	Alpha/beta hydrolase domain
3	PF02230 Abhydrolase_2	85	14.4	Phospholipase/Carboxylesterase
4	PF08386 Abhydrolase_4	6.1e+02	12.0	TAP-like protein
5	PF12697 Abhydrolase_6	5.4e-12	58.3	Alpha/beta hydrolase family
6	PF08840 BAAT_C	1.1e+02	14.3	BAAT / Acyl-CoA thioester hydrolase C terminal
7	PF20434 BD-FAE	8.7	17.3	BD-FAE
8	PF01738 DLH	46	15.0	Dienelactone hydrolase family
9	PF00756 Esterase	4.3e+02	11.9	Putative esterase
10	PF03959 FSH1	12	17.0	Serine hydrolase (FSH1)
11	PF12146 Hydrolase_4	1e-11	56.1	Serine aminopeptidase, S33
12	PF03583 LIP	17	16.2	Secretory lipase
13	PF00326 Peptidase_S9	5.7	17.9	Prolyl oligopeptidase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369739

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313921	0.799	Mitochondrial peptide methionine sulfoxide reductase
2	9606.ENSP00000303356	0.792	L-xylulose reductase
3	9606.ENSP00000436585	0.773	Ethylmalonyl-CoA decarboxylase
4	9606.ENSP00000173527	0.772	Isochorismatase domain containing 1
5	9606.ENSP00000446252	0.744	Superoxide dismutase [Mn], mitochondrial
6	9606.ENSP00000241052	0.709	Catalase
7	9606.ENSP00000297258	0.684	Fatty acid-binding protein, epidermal
8	9606.ENSP00000085068	0.639	Isochorismatase domain containing 2
9	9606.ENSP00000305924	0.629	Serine/threonine-protein phosphatase 4 regulatory subunit 4
10	9606.ENSP00000359693	0.579	Peptidylprolyl isomerase
11	9606.ENSP00000370373	0.579	Peptidyl-prolyl cis-trans isomerase FKBP1B
12	9606.ENSP00000383003	0.579	Peptidyl-prolyl cis-trans isomerase FKBP1A
13	9606.ENSP00000416583	0.563	Deoxyribose-phosphate aldolase
14	9606.ENSP00000259808	0.547	Receptor-interacting serine/threonine-protein kinase 1
15	9606.ENSP00000225174	0.532	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
16	9606.ENSP00000256104	0.530	Fatty acid-binding protein, adipocyte
17	9606.ENSP00000216330	0.528	Peptidyl-prolyl cis-trans isomerase FKBP3
18	9606.ENSP00000012443	0.526	Serine/threonine-protein phosphatase 5
19	9606.ENSP00000365686	0.513	Solute carrier family 15 member 1
20	9606.ENSP00000379217	0.505	Ubiquitin domain-containing protein UBFD1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0052689	1.000	carboxylic ester hydrolase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0050896	0.968	response to stimulus
GO:1901564	0.954	organonitrogen compound metabolic process
GO:0042221	0.932	response to chemical
GO:0044281	0.920	small molecule metabolic process
GO:0006082	0.852	organic acid metabolic process
GO:0043436	0.779	oxoacid metabolic process
GO:0019752	0.528	carboxylic acid metabolic process
GO:0009636	0.403	response to toxic substance
GO:0051716	0.369	cellular response to stimulus
GO:0006520	0.366	amino acid metabolic process
GO:0070887	0.311	cellular response to chemical stimulus
GO:0009410	0.306	response to xenobiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0016020	0.991	membrane
GO:0031090	0.977	organelle membrane
GO:0031967	0.888	organelle envelope
GO:0005740	0.788	mitochondrial envelope
GO:0031966	0.774	mitochondrial membrane
GO:0031974	0.706	membrane-enclosed lumen
GO:0070013	0.704	intracellular organelle lumen
GO:0098588	0.682	bounding membrane of organelle
GO:0019867	0.474	outer membrane
GO:0005829	0.467	cytosol
GO:0031968	0.411	organelle outer membrane
GO:0005743	0.386	mitochondrial inner membrane
GO:0005741	0.353	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.

[back to server]