StarFunc result for job id Q86WA8

User Input

>input (852 residues)
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVI
PNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYP
IAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQILDAVSLEERFKMTIPLLVRQIEGLKLLQKTRKPKQDDDK
RVIAIRPIRRITHISGTLEDEDEDEDNDDIVMLEKKIRTSSMPEQAHKVCVKEIKRLKKM
PQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKKRVLEYLAVR
QLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGS
MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAF
DLSQVLFIATANTTATIPAALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGLTPQQ
IQIPQVTTLDIITRYTREAGVRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGC
REHILEDEKPESISDTTDLALPPEMPILIDFHALKDILGPPMYEMEVSQRLSQPGVAIGL
AWTPLGGEIMFVEASRMDGEGQLTLTGQLGDVMKESAHLAISWLRSNAKKYQLTNAFGSF
DLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPV
GGIKDKVLAAHRAGLKQVIIPRRNEKDLEGIPGNVRQDLSFVTASCLDEVLNAAFDGGFT
VKTRPGLLNSKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3MIB4	0.672	0.672	0.000	852	0.951	0.951	Q3MIB4.pdb.gz	LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=2
2	AFDB:O64948	0.643	0.617	3.892E-101	888	0.450	0.431	O64948.pdb.gz	LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LON2 PE=2 SV=1
3	AFDB:P93647	0.640	0.617	4.393E-99	885	0.461	0.444	P93647.pdb.gz	LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays OX=4577 GN=LON1 PE=2 SV=1
4	AFDB:Q6TXI3	0.408	0.430	2.620E-96	806	0.678	0.717	Q6TXI3.pdb.gz	Q6TXI3_RAT LRRGT00016 OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=1
5	AFDB:P0A9M0	0.607	0.658	4.399E-83	784	0.352	0.383	P0A9M0.pdb.gz	LON_ECOLI Lon protease OS=Escherichia coli (strain K12) OX=83333 GN=lon PE=1 SV=1
6	AFDB:Q9I2T9	0.621	0.661	8.842E-83	798	0.366	0.391	Q9I2T9.pdb.gz	Q9I2T9_PSEAE Lon protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lon PE=2 SV=1
7	AFDB:A0A059VAZ3	0.587	0.628	3.770E-82	793	0.377	0.405	A0A059VAZ3.pdb.gz	A0A059VAZ3_9DEIN Lon protease OS=Meiothermus taiwanensis OX=172827 GN=lonA1 PE=1 SV=1
8	AFDB:P93655	0.606	0.552	1.483E-77	940	0.322	0.291	P93655.pdb.gz	LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON1 PE=1 SV=2
9	AFDB:P36775	0.606	0.458	2.825E-77	1133	0.318	0.239	P36775.pdb.gz	LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIM1 PE=1 SV=2
10	AFDB:Q9M9L8	0.594	0.549	4.115E-77	924	0.317	0.292	Q9M9L8.pdb.gz	LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON3 PE=3 SV=1
11	PDB:7fd4B	0.520	0.563	2.444E-71	779	0.379	0.415	7fd4B.pdb.gz	Complete three-dimensional structures of the Lon protease translocating a protein substrate.
12	PDB:6u5zA	0.584	0.925	8.935E-62	529	0.304	0.490	6u5zA.pdb.gz
13	PDB:7oxoA	0.558	0.610	5.402E-57	776	0.324	0.356	7oxoA.pdb.gz	Catalytic cycling of human mitochondrial Lon protease.
14	PDB:7p09F	0.505	0.780	8.473E-54	520	0.269	0.440	7p09F.pdb.gz	A dual allosteric pathway drives human mitochondrial Lon
15	PDB:8a8wD	0.237	0.335	9.725E-10	577	0.087	0.128	8a8wD.pdb.gz	Structure of the drug target ClpC1 unfoldase in action provides insights on antibiotic mechanism of action.
16	PDB:1ksfX	0.219	0.256	5.423E-9	714	0.075	0.090	1ksfX.pdb.gz	Crystal structure of ClpA, an HSP100 chaperone and regulator of ClpAP protease
17	PDB:6qs6C	0.259	0.340	1.675E-8	630	0.081	0.110	6qs6C.pdb.gz	Two-Step Activation Mechanism of the ClpB Disaggregase for Sequential Substrate Threading by the Main ATPase Motor.
18	PDB:6qs6B	0.258	0.366	2.440E-8	582	0.081	0.119	6qs6B.pdb.gz	Two-Step Activation Mechanism of the ClpB Disaggregase for Sequential Substrate Threading by the Main ATPase Motor.
19	PDB:6w6jD	0.241	0.285	2.440E-8	707	0.085	0.102	6w6jD.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
20	PDB:3pxiC	0.197	0.231	7.536E-8	711	0.097	0.117	3pxiC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A059VAZ3	0.0	544	793	0.386	0.415	A0A059VAZ3_9DEIN Lon protease OS=Meiothermus taiwanensis OX=172827 GN=lonA1 PE=1 SV=1
2	O64948	0.0	679	888	0.459	0.440	LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LON2 PE=2 SV=1
3	P93647	0.0	680	885	0.468	0.451	LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays OX=4577 GN=LON1 PE=2 SV=1
4	Q3MIB4	0.0	1641	852	0.952	0.952	LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=2
5	Q6TXI3	0.0	1011	806	0.592	0.625	Q6TXI3_RAT LRRGT00016 OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=1
6	Q86WA8	0.0	1738	852	1.000	1.000	LONP2_HUMAN Lon protease homolog 2, peroxisomal OS=Homo sapiens OX=9606 GN=LONP2 PE=1 SV=1
7	Q9DBN5	0.0	1642	852	0.955	0.955	LONP2_MOUSE Lon protease homolog 2, peroxisomal OS=Mus musculus OX=10090 GN=Lonp2 PE=1 SV=1
8	Q9I2T9	4.71e-177	532	798	0.364	0.388	Q9I2T9_PSEAE Lon protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lon PE=2 SV=1
9	P0A9M0	5.35e-168	508	784	0.352	0.383	LON_ECOLI Lon protease OS=Escherichia coli (strain K12) OX=83333 GN=lon PE=1 SV=1
10	Q9I5F9	4.01e-157	481	799	0.326	0.348	Q9I5F9_PSEAE Lon protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lon PE=2 SV=1
11	P93655	5.48e-154	477	940	0.325	0.295	LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON1 PE=1 SV=2
12	K7EJE8	1.03e-153	473	829	0.304	0.312	K7EJE8_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=1
13	K7EKE6	1.81e-153	473	845	0.304	0.307	K7EKE6_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=1
14	P36776	1.04e-151	471	959	0.304	0.270	LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2
15	Q924S5	2.53e-150	468	950	0.304	0.273	LONM_RAT Lon protease homolog, mitochondrial OS=Rattus norvegicus OX=10116 GN=Lonp1 PE=2 SV=1
16	Q59HJ6	3.17e-150	468	961	0.300	0.266	LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus OX=9913 GN=LONP1 PE=1 SV=1
17	Q8CGK3	3.18e-150	468	949	0.303	0.272	LONM_MOUSE Lon protease homolog, mitochondrial OS=Mus musculus OX=10090 GN=Lonp1 PE=1 SV=2
18	O44952	6.98e-148	462	971	0.303	0.266	LONM_CAEEL Lon protease homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=lonp-1 PE=3 SV=1
19	Q9M9L8	8.09e-147	458	924	0.291	0.268	LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON3 PE=3 SV=1
20	Q7KUT2	3.76e-146	459	1024	0.289	0.240	LONM_DROME Lon protease homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Lon PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.5e-17	75.7	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.67	21.8	AAA ATPase domain
3	PF13238 AAA_18	43	16.1	AAA domain
4	PF07724 AAA_2	4.3	18.9	AAA domain (Cdc48 subfamily)
5	PF13401 AAA_22	6	18.6	AAA domain
6	PF07726 AAA_3	1.4	20.2	ATPase family associated with various cellular activities (AAA)
7	PF13671 AAA_33	2.7e+02	13.1	AAA domain
8	PF07728 AAA_5	5.5e-05	34.6	AAA domain (dynein-related subfamily)
9	PF08298 AAA_PrkA	9.2	16.7	PrkA AAA domain
10	PF13541 ChlI	0.11	23.8	Subunit ChlI of Mg-chelatase
11	PF05362 Lon_C	7.1e-76	265.8	Lon protease (S16) C-terminal proteolytic domain
12	PF02190 LON_substr_bdg	2.5e-19	81.5	ATP-dependent protease La (LON) substrate-binding domain
13	PF03215 Rad17	1.4e+02	13.8	Rad17 P-loop domain
14	PF03193 RsgA_GTPase	51	15.2	RsgA GTPase
15	PF05496 RuvB_N	57	14.9	Holliday junction DNA helicase RuvB P-loop domain
16	PF01202 SKI	1.2e+02	14.2	Shikimate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285737

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348775	0.974	Peroxisomal acyl-coenzyme A oxidase 3
2	9606.ENSP00000287078	0.973	Peroxisomal leader peptide-processing protease
3	9606.ENSP00000360569	0.972	Non-specific lipid-transfer protein
4	9606.ENSP00000369461	0.972	Enoyl-CoA delta isomerase 2, mitochondrial
5	9606.ENSP00000317721	0.971	Peroxisomal sarcosine oxidase
6	9606.ENSP00000217455	0.968	Acyl-coenzyme A thioesterase 8
7	9606.ENSP00000221418	0.967	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
8	9606.ENSP00000355607	0.967	Glyceronephosphate O-acyltransferase
9	9606.ENSP00000231887	0.966	Peroxisomal bifunctional enzyme
10	9606.ENSP00000259407	0.965	Bile acid-CoA:amino acid N-acyltransferase
11	9606.ENSP00000265322	0.965	Peroxisomal trans-2-enoyl-CoA reductase
12	9606.ENSP00000483507	0.963	Hydroxyacid oxidase 2
13	9606.ENSP00000307697	0.961	Peroxisomal acyl-coenzyme A oxidase 2
14	9606.ENSP00000323071	0.961	Acyl-coenzyme A thioesterase 4
15	9606.ENSP00000368066	0.959	Hydroxyacid oxidase 1
16	9606.ENSP00000371517	0.959	Alpha-methylacyl-CoA racemase
17	9606.ENSP00000413575	0.957	Peroxisomal carnitine O-octanoyltransferase
18	9606.ENSP00000302620	0.956	Alanine-glyoxylate aminotransferase
19	9606.ENSP00000241052	0.949	Catalase
20	9606.ENSP00000262430	0.949	Malonyl-CoA decarboxylase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.997	catalytic activity
GO:0016787	0.990	hydrolase activity
GO:0008233	0.968	peptidase activity
GO:0019899	0.666	enzyme binding
GO:0140657	0.399	ATP-dependent activity
GO:0003676	0.341	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0071704	0.975	organic substance metabolic process
GO:0044238	0.971	primary metabolic process
GO:0006807	0.781	nitrogen compound metabolic process
GO:1901564	0.768	organonitrogen compound metabolic process
GO:0065007	0.690	biological regulation
GO:0043170	0.672	macromolecule metabolic process
GO:0050789	0.576	regulation of biological process
GO:0071840	0.545	cellular component organization or biogenesis
GO:0050794	0.545	regulation of cellular process
GO:0050896	0.525	response to stimulus
GO:0016043	0.504	cellular component organization
GO:0006996	0.457	organelle organization
GO:0044237	0.447	cellular metabolic process
GO:0019222	0.440	regulation of metabolic process
GO:0019538	0.428	protein metabolic process
GO:0006508	0.313	proteolysis
GO:0031323	0.312	regulation of cellular metabolic process
GO:0080090	0.303	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	1.000	intracellular organelle lumen
GO:0042579	0.996	microbody
GO:0016020	0.993	membrane
GO:0005782	0.987	peroxisomal matrix
GO:0005634	0.980	nucleus
GO:0005829	0.973	cytosol
GO:0031981	0.368	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.990	Hydrolases.
EC:3.4.-.-	0.968	Acting on peptide bonds (peptidases).

[back to server]