StarFunc result for job id Q86WC6

User Input

>input (154 residues)
MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATI
HPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLG
ADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WC6	1.000	1.000	6.225E-25	154	1.000	1.000	Q86WC6.pdb.gz	PPR27_HUMAN Protein phosphatase 1 regulatory subunit 27 OS=Homo sapiens OX=9606 GN=PPP1R27 PE=1 SV=1
2	AFDB:Q9BZL4	0.618	0.133	1.434E-8	782	0.409	0.081	Q9BZL4.pdb.gz	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
3	AFDB:Q6DRG7	0.678	0.108	1.591E-8	1049	0.344	0.051	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
4	AFDB:Q10728	0.679	0.110	1.959E-8	1032	0.312	0.047	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
5	AFDB:Q90623	0.677	0.113	2.675E-8	1004	0.338	0.052	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
6	AFDB:F8VZN8	0.679	0.163	3.654E-8	692	0.338	0.075	F8VZN8.pdb.gz	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
7	AFDB:M9NEB2	0.708	0.093	9.312E-8	1273	0.325	0.039	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
8	AFDB:Q9VBP3	0.632	0.095	1.272E-7	1181	0.279	0.036	Q9VBP3.pdb.gz	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
9	AFDB:M9PCQ3	0.708	0.106	1.340E-7	1111	0.318	0.044	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
10	AFDB:Q86RA0	0.709	0.126	1.411E-7	927	0.318	0.053	Q86RA0.pdb.gz	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
11	PDB:7df7B	0.663	0.845	3.375E-6	119	0.201	0.261	7df7B.pdb.gz
12	PDB:6jd6B	0.534	0.437	6.633E-6	192	0.266	0.214	6jd6B.pdb.gz
13	PDB:3ehqA	0.701	0.600	1.115E-5	182	0.201	0.170	3ehqA.pdb.gz
14	PDB:8cs9A	0.706	0.145	1.605E-5	796	0.227	0.044	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
15	PDB:2dvwA	0.654	0.450	4.089E-5	229	0.162	0.109	2dvwA.pdb.gz
16	PDB:6v9hC	0.653	0.391	9.892E-5	270	0.214	0.122	6v9hC.pdb.gz
17	PDB:6mwqA	0.635	0.211	1.042E-4	493	0.240	0.075	6mwqA.pdb.gz
18	PDB:4oauC	0.635	0.154	1.283E-4	692	0.175	0.039	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
19	PDB:1wg0A	0.648	0.423	1.944E-4	243	0.182	0.115	1wg0A.pdb.gz
20	PDB:5vkqA	0.621	0.068	1.944E-4	1499	0.201	0.021	5vkqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86WC6	8.83e-112	315	154	1.000	1.000	PPR27_HUMAN Protein phosphatase 1 regulatory subunit 27 OS=Homo sapiens OX=9606 GN=PPP1R27 PE=1 SV=1
2	A0A0S2Z4Q8	2.56e-25	97.4	184	0.331	0.277	A0A0S2Z4Q8_HUMAN Protein phosphatase 1 regulatory subunit 12B isoform 2 OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=1
3	Q9BZL4	1.00e-23	98.2	782	0.364	0.072	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
4	M9NFZ0	9.20e-23	94.0	341	0.325	0.147	M9NFZ0_DROME Myosin binding subunit, isoform P OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
5	A8JNT4	5.57e-22	93.2	925	0.325	0.054	A8JNT4_DROME Myosin binding subunit, isoform H OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
6	Q86RA0	5.57e-22	93.2	927	0.325	0.054	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
7	Q8BG95	5.71e-22	93.2	976	0.357	0.056	MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus OX=10090 GN=Ppp1r12b PE=1 SV=2
8	A8JNT5	6.08e-22	93.2	795	0.325	0.063	A8JNT5_DROME Myosin binding subunit, isoform G OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
9	Q86R99	6.08e-22	93.2	797	0.325	0.063	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
10	M9NDA1	9.10e-22	92.8	1230	0.325	0.041	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
11	M9PCQ3	9.11e-22	92.8	1111	0.325	0.045	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
12	M9NDS8	9.47e-22	92.8	1245	0.325	0.040	M9NDS8_DROME Myosin binding subunit, isoform N OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
13	Q8MV37	9.93e-22	92.4	1101	0.325	0.045	Q8MV37_DROME Myosin binding subunit of myosin phosphatase OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
14	M9NFF6	1.02e-21	92.4	1243	0.325	0.040	M9NFF6_DROME Myosin binding subunit, isoform M OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
15	M9NEB2	1.06e-21	92.4	1273	0.325	0.039	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
16	O60237	1.39e-21	92.0	982	0.370	0.058	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
17	Q9VUX6	2.69e-20	88.6	860	0.325	0.058	Q9VUX6_DROME Myosin binding subunit, isoform K OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=3
18	Q8IQN4	4.08e-20	87.8	1144	0.325	0.044	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
19	Q8MT32	4.28e-20	87.8	1144	0.325	0.044	Q8MT32_DROME RE63915p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
20	Q90623	5.76e-20	87.4	1004	0.318	0.049	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	5.3e-11	53.6	Ankyrin repeat
2	PF12796 Ank_2	2e-11	55.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.4e-11	52.3	Ankyrin repeat
4	PF13637 Ank_4	3.1e-13	61.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	8.9e-14	62.6	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331065

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261167	0.739	WW domain-binding protein 11
2	9606.ENSP00000219409	0.634	Rho GDP-dissociation inhibitor 3
3	9606.ENSP00000269321	0.606	Rho GDP-dissociation inhibitor 1
4	9606.ENSP00000382670	0.575	Glutaredoxin domain-containing cysteine-rich protein 1
5	9606.ENSP00000345917	0.572	Cell growth-regulating nucleolar protein
6	9606.ENSP00000219406	0.565	Protein disulfide-isomerase A2
7	9606.ENSP00000363317	0.531	FERM and PDZ domain-containing protein 2
8	9606.ENSP00000228284	0.510	Squamous cell carcinoma antigen recognized by T-cells 3
9	9606.ENSP00000266397	0.503	Endoplasmic reticulum protein 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.997	enzyme binding
GO:0019902	0.992	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.977	regulation of biological process
GO:0032501	0.948	multicellular organismal process
GO:0009987	0.930	cellular process
GO:0050794	0.911	regulation of cellular process
GO:0032502	0.878	developmental process
GO:0048856	0.784	anatomical structure development
GO:0007275	0.730	multicellular organism development
GO:0048519	0.398	negative regulation of biological process
GO:0019222	0.382	regulation of metabolic process
GO:0051171	0.360	regulation of nitrogen compound metabolic process
GO:0071840	0.319	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043227	0.978	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0005737	0.977	cytoplasm
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0005634	0.878	nucleus
GO:0005829	0.869	cytosol
GO:0071944	0.338	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]