StarFunc result for job id Q86WG5

User Input

>input (1849 residues)
MARLADYFIVVGYDHEKPGSGEGLGKIIQRFPQKDWDDTPFPQGIELFCQPGGWQLSRER
KQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGEAKVSGLIQPAEVFAPKS
LVLVSRLYYPEIFRACLGLIYTVYVDSLNVSLESLIANLCACLVPAAGGSQKLFSLGAGD
RQLIQTPLHDSLPITGTSVALLFQQLGIQNVLSLFCAVLTENKVLFHSASFQRLSDACRA
LESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSVFKTDVHELLDVIIADLDGGTI
KIPECIHLSSLPEPLLHQTQSALSLILHPDLEVADHAFPPPRTALSHSKMLDKEVRAVFL
RLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLSGMAFAGFVSER
GPPYRSCDLFDELVAFEVERIKVEENNPVKMIKHVRELAEQLFKNENPNPHMAFQKVPRP
TEGSHLRVHILPFPEINEARVQELIQENVAKNQNAPPATRIEKKCVVPAGPPVVSIMDKV
TTVFNSAQRLEVVRNCISFIFENKILETEKTLPAALRALKGKAARQCLTDELGLHVQQNR
AILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQDH
PIWTNQQFWETTFYNAVQEQVRSLYLSAKEDNHAPHLKQKDKLPDDHYQEKTAMDLAAEQ
LRLWPTLSKSTQQELVQHEESTVFSQAIHFANLMVNLLVPLDTSKNKLLRTSAPGDWESG
SNSIVTNSIAGSVAESYDTESGFEDSENTDIANSVVRFITRFIDKVCTESGVTQDHIKSL
HCMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREE
ATGGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITMQN
QLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIFKKQLMKFRYPQSIFSTFAFAAGQT
TPQIILPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQYLLKKKTGTIVEERVNRPGWNE
DDDVSVSDESELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGSSSRSRPEYFRI
TASNRMYSLCRSYPGLLVVPQAVQDSSLPRVARCYRHNRLPVVCWKNSRSGTLLLRSGGF
HGKGVVGLFKSQNSPQAAPTSSLESSSSIEQEKYLQALLNAVSVHQKLRGNSTLTVRPAF
ALSPGVWASLRSSTRLISSPTSFIDVGARLAGKDHSASFSNSSYLQNQLLKRQAALYIFG
EKSQLRNFKVEFALNCEFVPVEFHEIRQVKASFKKLMRACIPSTIPTDSEVTFLKALGDS
EWFPQLHRIMQLAVVVSEVLENGSSVLVCLEEGWDITAQVTSLVQLLSDPFYRTLEGFQM
LVEKEWLSFGHKFSQRSSLTLNCQGSGFAPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFL
AFHYVSNRFKTFLLDSDYERLEHGTLFDDKGEKHAKKGVCIWECIDRMHKRSPIFFNYLY
SPLEIEALKPNVNVSSLKKWDYYIEETLSTGPSYDWMMLTPKHFPSEDSDLAGEAGPRSQ
RRTVWPCYDDVSCTQPDALTSLFSEIEKLEHKLNQAPEKWQQLWERVTVDLKEEPRTDRS
QRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERRAATLYSQYTSKN
DENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPA
GPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDKIQSCISDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PXF8	0.870	0.860	0.000	1872	0.938	0.926	E9PXF8.pdb.gz	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
2	AFDB:M0RAP5	0.774	0.757	0.000	1893	0.598	0.584	M0RAP5.pdb.gz	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
3	AFDB:O95248	0.778	0.771	0.000	1868	0.597	0.591	O95248.pdb.gz	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
4	AFDB:Q86WG5	1.000	1.000	0.000	1849	1.000	1.000	Q86WG5.pdb.gz	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
5	AFDB:Q9VGH9	0.626	0.586	0.000	1993	0.441	0.409	Q9VGH9.pdb.gz	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
6	PDB:1lw3A	0.246	0.846	3.248E-27	513	0.092	0.331	1lw3A.pdb.gz
7	AFDB:Q13615	0.228	0.347	2.622E-26	1198	0.097	0.149	Q13615.pdb.gz	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
8	AFDB:G5EBF2	0.247	0.556	1.168E-25	782	0.089	0.210	G5EBF2.pdb.gz	G5EBF2_CAEEL phosphatidylinositol-3-phosphatase OS=Caenorhabditis elegans OX=6239 GN=mtm-6 PE=1 SV=1
9	AFDB:Q8RXA7	0.213	0.322	1.508E-25	1187	0.089	0.138	Q8RXA7.pdb.gz	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
10	AFDB:Q8MLR7	0.246	0.567	2.522E-24	761	0.081	0.197	Q8MLR7.pdb.gz	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
11	AFDB:Q9N589	0.248	0.731	6.729E-24	588	0.076	0.240	Q9N589.pdb.gz	MTMR1_CAEEL Myotubularin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mtm-1 PE=1 SV=2
12	PDB:3ljuX	0.050	0.237	2.515E-4	373	0.011	0.056	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:6bbpA	0.050	0.173	1.120E-3	520	0.015	0.054	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	PDB:4iapA	0.041	0.275	2.313E-3	256	0.012	0.086	4iapA.pdb.gz
15	PDB:6nzdH	0.079	0.306	3.118E-3	387	0.025	0.119	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
16	PDB:6u3eA	0.048	0.218	4.387E-3	397	0.016	0.073	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
17	PDB:3uzsA	0.052	0.151	4.579E-3	609	0.010	0.030	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
18	PDB:6xtbE	0.051	0.335	4.778E-3	235	0.017	0.136	6xtbE.pdb.gz
19	PDB:6ulgL	0.081	0.266	5.431E-3	458	0.033	0.133	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
20	PDB:3pvuA	0.049	0.141	5.915E-3	609	0.010	0.030	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AD51	0.0	2196	1875	0.599	0.590	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
2	E9PXF8	0.0	3567	1872	0.939	0.927	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
3	M0RAP5	0.0	2195	1893	0.599	0.585	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
4	O95248	0.0	2199	1868	0.599	0.593	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
5	O96610	0.0	1049	1750	0.333	0.352	O96610_DROME SET domain binding factor OS=Drosophila melanogaster OX=7227 GN=Sbf PE=2 SV=1
6	Q6ZPE2	0.0	2196	1867	0.596	0.590	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
7	Q7KSP6	0.0	1339	1973	0.404	0.379	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
8	Q86WG5	0.0	3841	1849	1.000	1.000	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
9	Q960A9	0.0	1107	1728	0.339	0.363	Q960A9_DROME SD10541p OS=Drosophila melanogaster OX=7227 GN=Sbf PE=2 SV=1
10	Q9VGH9	0.0	1330	1993	0.404	0.375	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
11	H0Y5W8	7.46e-147	462	425	0.125	0.546	H0Y5W8_HUMAN SET binding factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=2
12	Q9Z2D1	3.28e-46	180	643	0.075	0.215	MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus OX=10090 GN=Mtmr2 PE=1 SV=3
13	Q13614	6.12e-46	179	643	0.074	0.212	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
14	D3ZA31	2.95e-45	176	571	0.073	0.236	D3ZA31_RAT Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr2 PE=1 SV=2
15	Q13615	1.41e-44	180	1198	0.075	0.115	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
16	A0A8I6AT43	9.69e-42	171	1195	0.072	0.112	A0A8I6AT43_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
17	D3ZW40	1.09e-41	171	1191	0.072	0.113	D3ZW40_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=2
18	A0A8I6AFY1	1.70e-41	170	1216	0.072	0.110	A0A8I6AFY1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
19	A0A8I6A3Q2	1.74e-41	170	1205	0.072	0.111	A0A8I6A3Q2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
20	Q9NYA4	1.99e-41	169	1195	0.072	0.111	MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens OX=9606 GN=MTMR4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	0.034	25.5	dDENN domain
2	PF02141 DENN	2.5e-50	182.5	DENN (AEX-3) domain
3	PF02893 GRAM	8.3e-12	56.4	GRAM domain
4	PF06602 Myotub-related	1.3e-81	286.0	Myotubularin-like phosphatase domain
5	PF00169 PH	6.5e-11	54.0	PH domain
6	PF15413 PH_11	2.8	19.8	Pleckstrin homology domain
7	PF16652 PH_13	1.5e+02	13.7	Pleckstrin homology domain
8	PF08458 PH_2	16	17.3	Plant pleckstrin homology-like region
9	PF14593 PH_3	3.1	19.2	PH domain
10	PF15409 PH_8	0.58	21.8	Pleckstrin homology domain
11	PF15410 PH_9	1.1e+02	14.4	Pleckstrin homology domain
12	PF12335 SBF2	4.2e-102	352.1	Myotubularin protein
13	PF08616 SPA	1.2	20.5	Stabilization of polarity axis
14	PF12104 Tcell_CD4_C	2.3e+02	13.8	T cell CD4 receptor C terminal region
15	PF03456 uDENN	7.5e-16	69.7	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256190

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261263	0.975	Ras-related protein Rab-21
2	9606.ENSP00000350386	0.905	Rab proteins geranylgeranyltransferase component A 1
3	9606.ENSP00000355511	0.905	Rab proteins geranylgeranyltransferase component A 2
4	9606.ENSP00000369538	0.905	Rab GDP dissociation inhibitor beta
5	9606.ENSP00000394071	0.903	Rab GDP dissociation inhibitor alpha
6	9606.ENSP00000230124	0.881	Polyphosphoinositide phosphatase
7	9606.ENSP00000423660	0.875	SH3 domain and tetratricopeptide repeats 2
8	9606.ENSP00000345752	0.864	Myotubularin-related protein 2
9	9606.ENSP00000394487	0.811	FYVE, RhoGEF and PH domain-containing protein 4
10	9606.ENSP00000220822	0.774	Ganglioside-induced differentiation-associated protein 1
11	9606.ENSP00000261654	0.725	Adhesion G-protein coupled receptor D1
12	9606.ENSP00000356581	0.720	Adhesion G-protein coupled receptor G6
13	9606.ENSP00000484525	0.717	RNA polymerase II subunit A C-terminal domain phosphatase
14	9606.ENSP00000316578	0.699	Polycomb protein SUZ12
15	9606.ENSP00000265970	0.663	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
16	9606.ENSP00000356155	0.661	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
17	9606.ENSP00000265074	0.648	Atrial natriuretic peptide receptor 3
18	9606.ENSP00000344401	0.642	Protein lin-28 homolog B
19	9606.ENSP00000359417	0.641	Myotubularin-related protein 1
20	9606.ENSP00000309714	0.637	SH3 and PX domain-containing protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019902	0.866	phosphatase binding
GO:0019208	0.821	phosphatase regulator activity
GO:0035091	0.796	phosphatidylinositol binding
GO:0042802	0.438	identical protein binding
GO:0003824	0.388	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0048522	0.851	positive regulation of cellular process
GO:0016043	0.847	cellular component organization
GO:0019222	0.764	regulation of metabolic process
GO:0006996	0.756	organelle organization
GO:0031323	0.752	regulation of cellular metabolic process
GO:0051128	0.702	regulation of cellular component organization
GO:0009893	0.701	positive regulation of metabolic process
GO:0080090	0.690	regulation of primary metabolic process
GO:0031325	0.688	positive regulation of cellular metabolic process
GO:0051171	0.676	regulation of nitrogen compound metabolic process
GO:0060255	0.675	regulation of macromolecule metabolic process
GO:0051179	0.661	localization
GO:0009889	0.555	regulation of biosynthetic process
GO:0031326	0.550	regulation of cellular biosynthetic process
GO:0010468	0.538	regulation of gene expression
GO:2001141	0.519	regulation of RNA biosynthetic process
GO:0032501	0.504	multicellular organismal process
GO:0051641	0.463	cellular localization
GO:0032784	0.461	regulation of DNA-templated transcription elongation
GO:0032502	0.366	developmental process
GO:0008152	0.363	metabolic process
GO:0006810	0.345	transport
GO:0044237	0.330	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0043229	0.970	intracellular organelle
GO:0043227	0.960	membrane-bounded organelle
GO:0043231	0.946	intracellular membrane-bounded organelle
GO:0071944	0.780	cell periphery
GO:0031090	0.710	organelle membrane
GO:0031974	0.642	membrane-enclosed lumen
GO:0005634	0.638	nucleus
GO:0070013	0.619	intracellular organelle lumen
GO:0012505	0.579	endomembrane system
GO:0005654	0.458	nucleoplasm
GO:0005886	0.405	plasma membrane
GO:0032991	0.401	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]