StarFunc result for job id Q86WI1

User Input

>input (1400 residues)
MGHLWLLGIWGLCGLLLCAADPSTDGSQIIPKVTEIIPKYGSINGATRLTIRGEGFSQAN
QFNYGVDNAELGNSVQLISSFQSITCDVEKDASHSTQITCYTRAMPEDSYTVRVSVDGVP
VTENNTCKGHINSWECTFNAKSFRTPTIRSITPLSGTPGTLITIQGRIFTDVYGSNIALS
SNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNGDMGSMVCKTTGTFIGHHNVSFI
LDNDYGRSFPQKMAYFVSSLNKIAMFQTYAEVTMIFPSQGSIRGGTTLTISGRFFDQTDF
PVRVLVGGEPCDILNVTENSICCKTPPKPHILKTVYPGGRGLKLEVWNNSRPIRLEEILE
YNEKTPGYMGASWVDSASYIWLMEQDTFVARFSGFLVAPDSDVYRFYIKGDDRYAIYFSQ
TGLPEDKVRIAYHSANANSYFSSPTQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQ
YRNVYTEQQTGDAVNEEQVIKSQSTILQEVQVITLENWETTNAINEVQKIKVTSPCVEAN
SCSLYQYRLIYNMEKTVFLPADASEFILQSALNDLWSIKPDTVQVIRTQNPQSYVYMVTF
ISTRGDFDLLGYEVVEGNNVTLDITEQTKGKPNLETFTLNWDGIASKPLTLWSSEAEFQG
AVEEMVSTKCPPQIANFEEGFVVKYFRDYETDFNLEHINRGQKTAETDAYCGRYSLKNPA
VLFDSADVKPNRRPYGDILLFPYNQLCLAYKGFLANYIGLKFQYQDNSKITRSTDTQFTY
NFAYGNNWTYTCIDLLDLVRTKYTGTNVSLQRISLHKASESQSFYVDVVYIGHTSTISTL
DEMPKRRLPALANKGIFLEHFQVNQTKTNGPTMTNQYSVTMTSYNCSYNIPMMAVSFGQI
ITHETENEFVYRGNNWPGESKIHIQRIQAASPPLSGSFDIQAYGHILKGLPAAVSAADLQ
FALQSLEGMGRISVTREGTCAGYAWNIKWRSTCGKQNLLQINDSNIIGEKANMTVTRIKE
GGLFRQHVLGDLLRTPSQQPQVEVYVNGIPAKCSGDCGFTWDSNITPLVLAISPSQGSYE
EGTILTIVGSGFSPSSAVTVSVGPVGCSLLSVDEKELKCQILNGSAGHAPVAVSMADVGL
AQNVGGEEFYFVYQSQISHIWPDSGSIAGGTLLTLSGFGFNENSKVLVGNETCNVIEGDL
NRITCRTPKKTEGTVDISVTTNGFQATARDAFSYNCLQTPIITDFSPKVRTILGEVNLTI
KGYNFGNELTQNMAVYVGGKTCQILHWNFTDIRCLLPKLSPGKHDIYVEVRNWGFASTRD
KLNSSIQYVLEVTSMFPQRGSLFGGTEITIRGFGFSTIPAENTVLLGSIPCNVTSSSENV
IKCILHSTGNIFRITNNGKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K2W1	0.291	0.264	5.374E-73	1613	0.187	0.162	A0A0G2K2W1.pdb.gz	A0A0G2K2W1_RAT PKHD1 ciliary IPT domain containing fibrocystin/polyductin OS=Rattus norvegicus OX=10116 GN=Pkhd1 PE=1 SV=2
2	AFDB:Q54TD1	0.093	0.081	6.667E-20	1630	0.110	0.094	Q54TD1.pdb.gz	Q54TD1_DICDI IPT/TIG domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281853 PE=4 SV=1
3	AFDB:Q9UIW2	0.129	0.102	1.631E-18	1896	0.094	0.070	Q9UIW2.pdb.gz	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
4	AFDB:Q95U66	0.090	0.100	1.878E-18	1148	0.092	0.112	Q95U66.pdb.gz	Q95U66_DROME GH03118p OS=Drosophila melanogaster OX=7227 GN=jbug PE=2 SV=1
5	AFDB:A0A0R4IRZ9	0.125	0.096	3.302E-18	1945	0.115	0.083	A0A0R4IRZ9.pdb.gz
6	AFDB:Q54IJ6	0.109	0.173	5.539E-18	853	0.098	0.161	Q54IJ6.pdb.gz	Q54IJ6_DICDI IPT/TIG domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=tgrM1 PE=4 SV=1
7	AFDB:P70208	0.128	0.101	9.292E-18	1872	0.092	0.069	P70208.pdb.gz	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
8	AFDB:Q9ULL4	0.126	0.099	2.614E-17	1909	0.093	0.068	Q9ULL4.pdb.gz	PLXB3_HUMAN Plexin-B3 OS=Homo sapiens OX=9606 GN=PLXNB3 PE=1 SV=2
9	AFDB:A0A2R8QPJ6	0.123	0.098	3.010E-17	1902	0.086	0.063	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
10	AFDB:D3ZZ80	0.080	0.066	3.010E-17	1805	0.085	0.066	D3ZZ80.pdb.gz	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
11	PDB:5a42A	0.070	0.065	1.869E-9	1597	0.084	0.073	5a42A.pdb.gz
12	PDB:6vxkB	0.089	0.144	3.972E-8	747	0.051	0.095	6vxkB.pdb.gz
13	PDB:5e7gA	0.067	0.154	1.228E-7	446	0.042	0.132	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
14	PDB:7sqcO0	0.058	0.066	9.718E-7	1140	0.071	0.087	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:1e07A	0.078	0.132	7.002E-6	642	0.049	0.107	1e07A.pdb.gz
16	PDB:4rtdA	0.054	0.063	1.290E-5	1122	0.079	0.099	4rtdA.pdb.gz
17	PDB:4lnvB	0.070	0.085	1.793E-5	1063	0.073	0.096	4lnvB.pdb.gz
18	PDB:7nycA	0.069	0.065	1.880E-5	1542	0.069	0.063	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:6h03A	0.056	0.063	3.805E-5	1223	0.096	0.110	6h03A.pdb.gz
20	PDB:4ziqA	0.067	0.066	4.593E-5	1450	0.077	0.074	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80ZA4	0.0	2365	4249	0.801	0.264	PKHL1_MOUSE Fibrocystin-L OS=Mus musculus OX=10090 GN=Pkhd1l1 PE=1 SV=1
2	Q86WI1	0.0	2905	4243	1.000	0.330	PKHL1_HUMAN Fibrocystin-L OS=Homo sapiens OX=9606 GN=PKHD1L1 PE=2 SV=2
3	E2RK30	4.97e-61	234	4074	0.149	0.051	PKHD1_CANLF Fibrocystin OS=Canis lupus familiaris OX=9615 GN=PKHD1 PE=3 SV=2
4	P08F94	4.65e-58	224	4074	0.148	0.051	PKHD1_HUMAN Fibrocystin OS=Homo sapiens OX=9606 GN=PKHD1 PE=1 SV=1
5	A0A0G2K2W1	1.27e-51	203	4052	0.141	0.049	A0A0G2K2W1_RAT PKHD1 ciliary IPT domain containing fibrocystin/polyductin OS=Rattus norvegicus OX=10116 GN=Pkhd1 PE=1 SV=2
6	Q6T3A5	8.53e-51	201	4060	0.144	0.050	Q6T3A5_MOUSE PKHD1 OS=Mus musculus OX=10090 GN=Pkhd1 PE=2 SV=1
7	E9PZ36	4.66e-50	198	4059	0.142	0.049	PKHD1_MOUSE Fibrocystin OS=Mus musculus OX=10090 GN=Pkhd1 PE=1 SV=1
8	P97523	3.11e-12	74.3	1382	0.051	0.051	MET_RAT Hepatocyte growth factor receptor OS=Rattus norvegicus OX=10116 GN=Met PE=1 SV=1
9	A0A2R8QPJ6	9.15e-11	69.3	1902	0.057	0.042	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
10	Q80UG2	1.31e-10	68.9	1893	0.061	0.045	PLXA4_MOUSE Plexin-A4 OS=Mus musculus OX=10090 GN=Plxna4 PE=1 SV=3
11	P16056	1.53e-10	68.6	1379	0.046	0.046	MET_MOUSE Hepatocyte growth factor receptor OS=Mus musculus OX=10090 GN=Met PE=1 SV=1
12	Q6BEA0	4.14e-10	67.4	1903	0.064	0.047	PLXA4_DANRE Plexin-A4 OS=Danio rerio OX=7955 GN=plxna4 PE=2 SV=1
13	P51805	8.53e-10	66.2	1871	0.062	0.046	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
14	Q6DSU3	2.35e-09	64.7	1880	0.038	0.028	Q6DSU3_DANRE Plexin D1 OS=Danio rerio OX=7955 GN=zgc:77379 PE=1 SV=1
15	P08581	2.57e-09	64.7	1390	0.036	0.036	MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4
16	P70206	2.98e-09	64.3	1894	0.070	0.052	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
17	Q9HCM2	2.98e-09	64.3	1894	0.066	0.049	PLXA4_HUMAN Plexin-A4 OS=Homo sapiens OX=9606 GN=PLXNA4 PE=1 SV=4
18	P70207	3.00e-09	64.3	1894	0.066	0.049	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
19	O75051	3.74e-09	64.3	1894	0.066	0.049	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
20	P70208	8.17e-09	63.2	1872	0.061	0.045	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10528 GLEYA	1.3	20.8	GLEYA domain
2	PF07691 PA14	2.1e-06	39.1	PA14 domain
3	PF01833 TIG	1.6e-87	299.0	IPT/TIG domain
4	PF20144 TIG_SUH	8.2	18.0	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367655

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242591	0.623	Intraflagellar transport protein 81 homolog
2	9606.ENSP00000355434	0.518	Olfactory receptor 2L13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.684	signaling receptor activity
GO:0004888	0.433	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007605	0.898	sensory perception of sound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.991	intracellular anatomical structure
GO:0043226	0.965	organelle
GO:0005829	0.859	cytosol
GO:0071944	0.849	cell periphery
GO:0120025	0.530	plasma membrane bounded cell projection
GO:0016020	0.482	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]