StarFunc result for job id Q86WI3

User Input

>input (1866 residues)
MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNK
LHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGL
KRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYRSQIPGSGQPHAFHQVYVPPI
LRRATASLDTPEGAIMGDVKVEDGADVSISDLFNTRVNKGPRVTVLLGKAGMGKTTLAHR
LCQKWAEGHLNCFQALFLFEFRQLNLITRFLTPSELLFDLYLSPESDHDTVFQYLEKNAD
QVLLIFDGLDEALQPMGPDGPGPVLTLFSHLCNGTLLPGCRVMATSRPGKLPACLPAEAA
MVHMLGFDGPRVEEYVNHFFSAQPSREGALVELQTNGRLRSLCAVPALCQVACLCLHHLL
PDHAPGQSVALLPNMTQLYMQMVLALSPPGHLPTSSLLDLGEVALRGLETGKVIFYAKDI
APPLIAFGATHSLLTSFCVCTGPGHQQTGYAFTHLSLQEFLAALHLMASPKVNKDTLTQY
VTLHSRWVQRTKARLGLSDHLPTFLAGLASCTCRPFLSHLAQGNEDCVGAKQAAVVQVLK
KLATRKLTGPKVVELCHCVDETQEPELASLTAQSLPYQLPFHNFPLTCTDLATLTNILEH
REAPIHLDFDGCPLEPHCPEALVGCGQIENLSFKSRKCGDAFAEALSRSLPTMGRLQMLG
LAGSKITARGISHLVKALPLCPQLKEVSFRDNQLSDQVVLNIVEVLPHLPRLRKLDLSSN
SICVSTLLCLARVAVTCPTVRMLQAREADLIFLLSPPTETTAELQRAPDLQESDGQRKGA
QSRSLTLRLQKCQLQVHDAEALIALLQEGPHLEEVDLSGNQLEDEGCRLMAEAASQLHIA
RKLDLSNNGLSVAGVHCVLRAVSACWTLAELHISLQHKTVIFMFAQEPEEQKGPQERAAF
LDSLMLQMPSELPLSSRRMRLTHCGLQEKHLEQLCKALGGSCHLGHLHLDFSGNALGDEG
AARLAQLLPGLGALQSLNLSENGLSLDAVLGLVRCFSTLQWLFRLDISFESQHILLRGDK
TSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLEL
QLSCEFLSDQSLETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLCPRVKKVDLRS
LHHATLHFRSNEEEEGVCCGRFTGCSLSQEHVESLCWLLSKCKDLSQVDLSANLLGDSGL
RCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSCPRVREASVNLGSEQSFRIHFSR
EDQAGKTLRLSECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQLAILLSLVGRPAG
LFSLRVQEPWADRARVLSLLEVCAQASGSVTEISISETQQQLCVQLEFPRQEENPEAVAL
RLAHCDLGAHHSLLVGQLMETCARLQQLSLSQVNLCEDDDASSLLLQSLLLSLSELKTFR
LTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQFDEEGTKALMRALEGKWMLKRLDLSHL
LLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDVGCCHLSEALRAATSLEELDLSHNQIGD
AGVQHLATILPGLPELRKIDLSGNSISSAGGVQLAESLVLCRRLEELMLGCNALGDPTAL
GLAQELPQHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELP
LLRQIDLVSCKIDNQTAKLLTSSFTSCPALEVILLSWNLLGDEAAAELAQVLPQMGRLKR
VDLEKNQITALGAWLLAEGLAQGSSIQVIRLWNNPIPCDMAQHLKSQEPRLDFAFFDNQP
QAPWGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C3VPR6	0.703	0.688	0.000	1915	0.635	0.619	C3VPR6.pdb.gz	NLRC5_MOUSE Protein NLRC5 OS=Mus musculus OX=10090 GN=Nlrc5 PE=1 SV=2
2	AFDB:Q86WI3	1.000	1.000	0.000	1866	1.000	1.000	Q86WI3.pdb.gz	NLRC5_HUMAN Protein NLRC5 OS=Homo sapiens OX=9606 GN=NLRC5 PE=1 SV=3
3	AFDB:A0A0G2K4Z7	0.325	0.575	5.194E-28	989	0.110	0.207	A0A0G2K4Z7.pdb.gz	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
4	AFDB:Q9HC29	0.260	0.444	1.411E-27	1040	0.112	0.201	Q9HC29.pdb.gz	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
5	AFDB:H3BLT9	0.213	0.340	3.045E-27	1112	0.154	0.258	H3BLT9.pdb.gz	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
6	AFDB:E9Q5R7	0.284	0.466	3.836E-27	1054	0.127	0.225	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
7	AFDB:Q6E804	0.261	0.454	4.831E-27	1013	0.111	0.204	Q6E804.pdb.gz	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
8	AFDB:Q8K3Z0	0.300	0.513	6.829E-27	1020	0.110	0.201	Q8K3Z0.pdb.gz	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
9	AFDB:F8W3K2	0.270	0.492	7.964E-27	980	0.104	0.198	F8W3K2.pdb.gz	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
10	AFDB:D4ADT7	0.280	0.521	1.418E-26	953	0.116	0.227	D4ADT7.pdb.gz	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1
11	PDB:7pzcA	0.286	0.489	1.170E-19	1010	0.111	0.206	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.291	0.604	1.964E-15	806	0.096	0.222	7lfhA.pdb.gz
13	PDB:6npyA	0.290	0.599	2.041E-15	798	0.086	0.202	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.199	0.397	3.116E-15	866	0.083	0.178	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:1a4yA	0.144	0.484	9.269E-12	460	0.063	0.257	1a4yA.pdb.gz
16	PDB:3jblA	0.131	0.243	3.327E-9	909	0.078	0.160	3jblA.pdb.gz
17	PDB:6o60C	0.161	0.623	5.699E-9	389	0.043	0.208	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
18	PDB:3b2dA	0.142	0.314	1.490E-8	601	0.063	0.195	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
19	PDB:3t6qA	0.125	0.298	1.549E-8	601	0.063	0.196	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:6b5bA	0.147	0.210	6.424E-8	1199	0.091	0.142	6b5bA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C3VPR6	0.0	2138	1915	0.634	0.618	NLRC5_MOUSE Protein NLRC5 OS=Mus musculus OX=10090 GN=Nlrc5 PE=1 SV=2
2	H0YGE2	0.0	2279	1180	0.611	0.966	H0YGE2_HUMAN NLR family CARD domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=NLRC5 PE=1 SV=1
3	Q86WI3	0.0	3749	1866	1.000	1.000	NLRC5_HUMAN Protein NLRC5 OS=Homo sapiens OX=9606 GN=NLRC5 PE=1 SV=3
4	C3VPR7	1.55e-38	160	1065	0.136	0.238	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
5	Q7RTR2	1.55e-38	160	1065	0.136	0.238	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
6	H3BLT9	3.29e-38	159	1112	0.136	0.228	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
7	Q5DU56	2.30e-37	156	1064	0.129	0.226	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
8	A0A0G2K4Z7	8.97e-35	147	1034	0.121	0.218	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
9	Q8K3Z0	1.86e-34	147	1020	0.118	0.217	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
10	Q80SY9	4.17e-34	145	1013	0.118	0.218	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
11	Q9HC29	1.47e-31	137	1040	0.116	0.208	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
12	D4A5W3	2.41e-29	130	932	0.103	0.206	D4A5W3_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=1
13	Q6E804	9.49e-29	128	1013	0.121	0.223	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
14	A0A060X8V7	4.75e-28	125	951	0.093	0.183	A0A060X8V7_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00047677001 PE=4 SV=1
15	A0A0K0KIB0	8.90e-28	125	954	0.093	0.182	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
16	P79621	4.13e-27	123	1155	0.100	0.162	C2TA_MOUSE MHC class II transactivator OS=Mus musculus OX=10090 GN=Ciita PE=1 SV=2
17	Q9GJE0	5.14e-27	122	1153	0.104	0.168	Q9GJE0_RAT MHC class II transactivator type I OS=Rattus norvegicus OX=10116 GN=Ciita PE=2 SV=1
18	Q9GJD8	6.22e-27	122	1052	0.104	0.184	Q9GJD8_RAT MHC class II transactivator type IV OS=Rattus norvegicus OX=10116 GN=Ciita PE=2 SV=1
19	A0A8I5ZK58	6.62e-27	122	1072	0.103	0.180	A0A8I5ZK58_RAT Class II, major histocompatibility complex, transactivator OS=Rattus norvegicus OX=10116 GN=Ciita PE=4 SV=1
20	Q9GJD9	7.21e-27	122	1073	0.104	0.181	Q9GJD9_RAT MHC class II transactivator type III OS=Rattus norvegicus OX=10116 GN=Ciita PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	14	17.6	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	2.4	20.0	AAA ATPase domain
3	PF13401 AAA_22	1e+02	14.6	AAA domain
4	PF13481 AAA_25	3.7e+02	12.1	AAA domain
5	PF13671 AAA_33	2.4e+02	13.3	AAA domain
6	PF18461 Atypical_Card	1.7e-39	145.0	Atypical caspase recruitment domain
7	PF03161 LAGLIDADG_2	3.7e+02	12.4	LAGLIDADG DNA endonuclease family
8	PF00560 LRR_1	0.63	21.6	Leucine Rich Repeat
9	PF12799 LRR_4	6.8e-17	72.5	Leucine Rich repeats (2 copies)
10	PF13516 LRR_6	7.5e-29	108.3	Leucine Rich repeat
11	PF13855 LRR_8	0.00031	31.7	Leucine rich repeat
12	PF05729 NACHT	1.7e-36	137.2	NACHT domain
13	PF17776 NLRC4_HD2	2.2e-12	59.1	NLRC4 helical domain HD2
14	PF17779 NOD2_WH	0.15	23.6	NOD2 winged helix domain
15	PF03193 RsgA_GTPase	4.9e+02	12.0	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369213	0.994	Probable ATP-dependent RNA helicase DDX58
2	9606.ENSP00000359424	0.977	Inhibitor of nuclear factor kappa-B kinase subunit alpha
3	9606.ENSP00000401980	0.963	Mitochondrial antiviral-signaling protein
4	9606.ENSP00000263642	0.949	Interferon-induced helicase C domain-containing protein 1
5	9606.ENSP00000430684	0.892	Inhibitor of nuclear factor kappa-B kinase subunit beta
6	9606.ENSP00000254325	0.829	MHC class II regulatory factor RFX1
7	9606.ENSP00000385090	0.764	NLR family CARD domain-containing protein 4
8	9606.ENSP00000346206	0.738	Antigen peptide transporter 1
9	9606.ENSP00000323889	0.729	E3 ubiquitin/ISG15 ligase TRIM25
10	9606.ENSP00000305071	0.702	DNA-binding protein RFXANK
11	9606.ENSP00000433138	0.678	Caspase-1
12	9606.ENSP00000328340	0.674	E3 ubiquitin-protein ligase RNF135
13	9606.ENSP00000428657	0.641	Baculoviral IAP repeat-containing protein 1
14	9606.ENSP00000357112	0.628	Interferon-inducible protein AIM2
15	9606.ENSP00000290524	0.626	DNA-binding protein RFX5
16	9606.ENSP00000428579	0.620	NACHT domain- and WD repeat-containing protein 1
17	9606.ENSP00000219596	0.604	Pyrin
18	9606.ENSP00000309501	0.586	NACHT and WD repeat domain containing 2
19	9606.ENSP00000363993	0.581	Proteasome subunit beta type-9
20	9606.ENSP00000399168	0.551	HLA class I histocompatibility antigen, B-7 alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0000987	0.991	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.991	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.932	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0097367	0.381	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0010468	0.992	regulation of gene expression
GO:0048518	0.990	positive regulation of biological process
GO:0048583	0.988	regulation of response to stimulus
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0048522	0.981	positive regulation of cellular process
GO:0009893	0.980	positive regulation of metabolic process
GO:0032102	0.976	negative regulation of response to external stimulus
GO:0031323	0.975	regulation of cellular metabolic process
GO:0098542	0.974	defense response to other organism
GO:0031348	0.971	negative regulation of defense response
GO:0006955	0.970	immune response
GO:0031349	0.964	positive regulation of defense response
GO:0045087	0.959	innate immune response
GO:0045088	0.958	regulation of innate immune response
GO:0009968	0.952	negative regulation of signal transduction
GO:0051090	0.951	regulation of DNA-binding transcription factor activity
GO:0010604	0.942	positive regulation of macromolecule metabolic process
GO:0045089	0.932	positive regulation of innate immune response
GO:0009967	0.917	positive regulation of signal transduction
GO:0002683	0.915	negative regulation of immune system process
GO:0051173	0.914	positive regulation of nitrogen compound metabolic process
GO:0009615	0.897	response to virus
GO:0031325	0.896	positive regulation of cellular metabolic process
GO:0002832	0.884	negative regulation of response to biotic stimulus
GO:0060338	0.861	regulation of type I interferon-mediated signaling pathway
GO:0009987	0.846	cellular process
GO:0032088	0.835	negative regulation of NF-kappaB transcription factor activity
GO:0050777	0.805	negative regulation of immune response
GO:0060760	0.768	positive regulation of response to cytokine stimulus
GO:0050790	0.762	regulation of catalytic activity
GO:0051607	0.759	defense response to virus
GO:0009891	0.755	positive regulation of biosynthetic process
GO:0045935	0.752	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.750	positive regulation of macromolecule biosynthetic process
GO:0045893	0.739	positive regulation of DNA-templated transcription
GO:0001960	0.695	negative regulation of cytokine-mediated signaling pathway
GO:0045824	0.677	negative regulation of innate immune response
GO:0051716	0.650	cellular response to stimulus
GO:0045944	0.641	positive regulation of transcription by RNA polymerase II
GO:0001817	0.507	regulation of cytokine production
GO:0071704	0.399	organic substance metabolic process
GO:0051246	0.367	regulation of protein metabolic process
GO:0010628	0.357	positive regulation of gene expression
GO:0007154	0.354	cell communication
GO:0007165	0.342	signal transduction
GO:0042221	0.337	response to chemical
GO:0001961	0.313	positive regulation of cytokine-mediated signaling pathway
GO:0044093	0.310	positive regulation of molecular function
GO:0010033	0.306	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.999	nucleus
GO:0043228	0.986	non-membrane-bounded organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005856	0.702	cytoskeleton
GO:0015630	0.601	microtubule cytoskeleton
GO:0070013	0.526	intracellular organelle lumen
GO:0032991	0.516	protein-containing complex
GO:0031981	0.512	nuclear lumen
GO:0005815	0.484	microtubule organizing center
GO:0005813	0.463	centrosome
GO:0005654	0.356	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]