StarFunc result for job id Q86WJ1

User Input

>input (897 residues)
MERAGATSRGGQAPGFLLRLHTEGRAEAARVQEQDLRQWGLTGIHLRSYQLEGVNWLAQR
FHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPG
LSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLK
NQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDI
EKESESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDA
FENETAKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLY
SGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQQPIFVFLLS
TRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVY
RKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGSTMDEIDLES
ILGETKDGQWVSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQK
TLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEE
KKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYV
SGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGV
LLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHL
PRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHSQSSSSSSRQLVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C1P7	0.544	0.614	0.000	792	0.880	0.996	A0A494C1P7.pdb.gz	A0A494C1P7_HUMAN Chromodomain helicase DNA binding protein 1 like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=1
2	AFDB:Q86WJ1	1.000	1.000	0.000	897	1.000	1.000	Q86WJ1.pdb.gz	CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=3
3	PDB:7epuB	0.398	0.457	6.122E-91	748	0.825	0.989	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
4	AFDB:Q24368	0.543	0.476	4.125E-54	1027	0.270	0.236	Q24368.pdb.gz	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
5	AFDB:B8A552	0.540	0.469	1.709E-53	1035	0.273	0.237	B8A552.pdb.gz	B8A552_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Danio rerio OX=7955 GN=chunp6878 PE=1 SV=1
6	AFDB:Q5A310	0.532	0.454	2.470E-53	1056	0.273	0.232	Q5A310.pdb.gz	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1
7	AFDB:P38144	0.541	0.431	3.571E-53	1129	0.279	0.221	P38144.pdb.gz	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
8	AFDB:A5WUY4	0.537	0.467	1.560E-52	1036	0.283	0.245	A5WUY4.pdb.gz	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1
9	AFDB:P40201	0.541	0.292	4.241E-52	1711	0.282	0.148	P40201.pdb.gz	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
10	AFDB:O60264	0.539	0.462	1.153E-51	1052	0.274	0.234	O60264.pdb.gz	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1
11	AFDB:B7ZLQ5	0.531	0.449	1.852E-51	1070	0.278	0.233	B7ZLQ5.pdb.gz	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
12	PDB:6jylK	0.485	0.843	3.244E-42	504	0.244	0.435	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
13	PDB:6tdaS	0.462	0.527	6.205E-37	783	0.224	0.257	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
14	PDB:6g0lM	0.450	0.471	1.519E-36	855	0.223	0.234	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
15	PDB:6uxwA	0.477	0.547	3.011E-36	778	0.221	0.254	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
16	PDB:6g0lW	0.455	0.465	3.439E-34	878	0.229	0.233	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
17	PDB:6kw3Y	0.495	0.786	4.475E-34	548	0.235	0.385	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
18	PDB:7oo3b	0.442	0.712	1.300E-32	534	0.185	0.311	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
19	PDB:6gejM	0.413	0.534	1.982E-32	688	0.205	0.267	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:5vvrM	0.410	0.690	9.022E-29	503	0.171	0.304	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRH8	0.0	1436	745	0.784	0.944	A0A0A0MRH8_HUMAN Chromodomain helicase DNA binding protein 1 like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=2
2	A0A0A0MSH9	0.0	1692	825	0.920	1.000	A0A0A0MSH9_HUMAN Chromodomain helicase DNA binding protein 1 like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=2
3	A0A494C179	0.0	970	516	0.538	0.936	A0A494C179_HUMAN Chromodomain helicase DNA binding protein 1 like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=1
4	A0A494C1P7	0.0	1065	792	0.572	0.648	A0A494C1P7_HUMAN Chromodomain helicase DNA binding protein 1 like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=1
5	Q86WJ1	0.0	1845	897	1.000	1.000	CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=3
6	A0A0A0MRP6	7.13e-144	455	1058	0.278	0.235	A0A0A0MRP6_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
7	Q6PGB8	4.86e-142	450	1046	0.275	0.236	SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus OX=10090 GN=Smarca1 PE=1 SV=1
8	Q24368	3.32e-141	447	1027	0.270	0.236	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
9	B7ZLQ5	3.47e-141	448	1070	0.278	0.233	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
10	P28370	3.71e-141	448	1054	0.278	0.236	SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2
11	A5WUY4	7.68e-140	444	1036	0.274	0.237	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1
12	O60264	1.97e-139	443	1052	0.278	0.237	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1
13	Q91ZW3	1.69e-138	441	1051	0.276	0.236	SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus OX=10090 GN=Smarca5 PE=1 SV=1
14	A2RUY6	2.71e-138	440	1028	0.274	0.239	A2RUY6_DANRE SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 OS=Danio rerio OX=7955 GN=smarca5 PE=2 SV=1
15	B8A552	3.85e-138	439	1035	0.274	0.238	B8A552_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Danio rerio OX=7955 GN=chunp6878 PE=1 SV=1
16	Q8RWY3	2.13e-137	438	1056	0.256	0.218	ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=4
17	F4JAV9	2.40e-137	438	1057	0.256	0.218	F4JAV9_ARATH Chromatin-remodeling protein 11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=1
18	F4JY24	1.98e-136	436	1069	0.266	0.224	CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
19	F4JY25	2.52e-136	436	1072	0.266	0.223	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
20	Q5A310	1.58e-134	431	1056	0.251	0.213	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	74	15.1	AAA domain
2	PF13872 AAA_34	2.5e+02	11.9	P-loop containing NTP hydrolase pore-1
3	PF00270 DEAD	1.2	20.4	DEAD/DEAH box helicase
4	PF11496 HDA2-3	0.022	25.5	Class II histone deacetylase complex subunits 2 and 3
5	PF00271 Helicase_C	9.2e-12	56.7	Helicase conserved C-terminal domain
6	PF04851 ResIII	3.9e-07	41.7	Type III restriction enzyme, res subunit
7	PF00176 SNF2-rel_dom	2e-61	219.3	SNF2-related domain
8	PF18766 SWI2_SNF2	51	15.0	SWI2/SNF2 ATPase
9	PF06309 Torsin	1.6e+02	13.8	Torsin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358262

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355759	0.987	Poly [ADP-ribose] polymerase 1
2	9606.ENSP00000352257	0.966	X-ray repair cross-complementing protein 6
3	9606.ENSP00000307208	0.954	Nucleosome-remodeling factor subunit BPTF
4	9606.ENSP00000250416	0.931	Poly [ADP-ribose] polymerase 2
5	9606.ENSP00000307004	0.929	Aprataxin and PNK-like factor
6	9606.ENSP00000376765	0.928	E3 SUMO-protein ligase PIAS3
7	9606.ENSP00000249636	0.920	E3 SUMO-protein ligase PIAS1
8	9606.ENSP00000348056	0.920	SUMO-conjugating enzyme UBC9
9	9606.ENSP00000428209	0.916	Ubiquitin-conjugating enzyme E2 variant 2
10	9606.ENSP00000316176	0.912	Ubiquitin-conjugating enzyme E2 N
11	9606.ENSP00000453872	0.910	E3 ubiquitin-protein ligase Arkadia
12	9606.ENSP00000285021	0.879	DNA repair protein complementing XP-C cells
13	9606.ENSP00000363286	0.879	DNA polymerase epsilon subunit 3
14	9606.ENSP00000357297	0.876	E3 ubiquitin-protein ligase RNF146
15	9606.ENSP00000216297	0.872	FACT complex subunit SPT16
16	9606.ENSP00000364270	0.870	DNA repair protein complementing XP-A cells
17	9606.ENSP00000347978	0.863	DNA repair protein complementing XP-G cells
18	9606.ENSP00000262887	0.827	DNA repair protein XRCC1
19	9606.ENSP00000363017	0.809	Replication protein A 32 kDa subunit
20	9606.ENSP00000278412	0.790	FACT complex subunit SSRP1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	0.999	heterocyclic compound binding
GO:0097159	0.999	organic cyclic compound binding
GO:0004386	0.998	helicase activity
GO:0140030	0.997	modification-dependent protein binding
GO:0140658	0.997	ATP-dependent chromatin remodeler activity
GO:0016887	0.995	ATP hydrolysis activity
GO:0140463	0.990	chromatin-protein adaptor activity
GO:0003678	0.968	DNA helicase activity
GO:0031491	0.967	nucleosome binding
GO:0003676	0.948	nucleic acid binding
GO:0000166	0.928	nucleotide binding
GO:0003677	0.661	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0044237	0.968	cellular metabolic process
GO:0071704	0.960	organic substance metabolic process
GO:0044238	0.943	primary metabolic process
GO:0006338	0.939	chromatin remodeling
GO:0050896	0.937	response to stimulus
GO:1901360	0.884	organic cyclic compound metabolic process
GO:0006281	0.869	DNA repair
GO:0050789	0.749	regulation of biological process
GO:0050794	0.659	regulation of cellular process
GO:0019222	0.477	regulation of metabolic process
GO:0060255	0.472	regulation of macromolecule metabolic process
GO:0080090	0.400	regulation of primary metabolic process
GO:0051171	0.400	regulation of nitrogen compound metabolic process
GO:0031323	0.349	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.987	cytoplasm
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0016020	0.934	membrane
GO:0005829	0.930	cytosol
GO:0005886	0.918	plasma membrane
GO:0005694	0.884	chromosome
GO:0032991	0.718	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.995	ATP + H2O = ADP + H(+) + phosphate

[back to server]