StarFunc result for job id Q86WK6

User Input

>input (493 residues)
MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKE
GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQ
LSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKV
WVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WK6	1.000	1.000	3.005E-88	493	1.000	1.000	Q86WK6.pdb.gz	AMGO1_HUMAN Amphoterin-induced protein 1 OS=Homo sapiens OX=9606 GN=AMIGO1 PE=1 SV=1
2	AFDB:Q80ZD7	0.781	0.781	1.156E-78	493	0.895	0.895	Q80ZD7.pdb.gz	AMGO1_RAT Amphoterin-induced protein 1 OS=Rattus norvegicus OX=10116 GN=Amigo1 PE=1 SV=1
3	AFDB:A8BAW4	0.670	0.893	7.623E-45	368	0.385	0.516	A8BAW4.pdb.gz
4	AFDB:Q7TNJ4	0.680	0.647	2.133E-43	520	0.412	0.390	Q7TNJ4.pdb.gz	AMGO2_RAT Amphoterin-induced protein 2 OS=Rattus norvegicus OX=10116 GN=Amigo2 PE=1 SV=1
5	AFDB:Q86SJ2	0.673	0.638	1.446E-41	522	0.406	0.383	Q86SJ2.pdb.gz	AMGO2_HUMAN Amphoterin-induced protein 2 OS=Homo sapiens OX=9606 GN=AMIGO2 PE=1 SV=1
6	AFDB:Q503I7	0.347	0.279	1.192E-21	647	0.245	0.187	Q503I7.pdb.gz	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
7	AFDB:E9QDQ3	0.259	0.174	2.853E-20	858	0.203	0.117	E9QDQ3.pdb.gz	E9QDQ3_DANRE Leucine-rich repeat-containing 4.1 OS=Danio rerio OX=7955 GN=lrrc4.1 PE=4 SV=2
8	AFDB:Q9NT99	0.266	0.203	2.853E-20	713	0.231	0.160	Q9NT99.pdb.gz	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
9	AFDB:F8W4D7	0.255	0.208	7.281E-20	619	0.219	0.174	F8W4D7.pdb.gz
10	AFDB:Q9VZZ4	0.356	0.126	2.062E-19	1527	0.197	0.064	Q9VZZ4.pdb.gz	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
11	PDB:1xcdA	0.330	0.518	5.543E-10	305	0.122	0.197	1xcdA.pdb.gz
12	PDB:2ft3F	0.312	0.480	1.035E-9	305	0.126	0.203	2ft3F.pdb.gz
13	PDB:7wv3A	0.326	0.243	1.532E-7	668	0.116	0.085	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
14	PDB:5y31B	0.252	0.244	1.791E-7	511	0.110	0.106	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
15	PDB:5yq5B	0.270	0.406	2.861E-7	306	0.130	0.209	5yq5B.pdb.gz
16	PDB:6hkwA	0.296	0.461	5.343E-7	306	0.095	0.154	6hkwA.pdb.gz
17	PDB:1m9sA	0.237	0.224	6.580E-7	523	0.101	0.096	1m9sA.pdb.gz
18	PDB:7tvfD	0.285	0.274	6.580E-7	515	0.083	0.080	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
19	PDB:6gffI	0.254	0.232	1.679E-6	551	0.122	0.109	6gffI.pdb.gz
20	PDB:7wrqA	0.308	0.273	2.295E-6	566	0.128	0.111	7wrqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80ZD7	0.0	867	493	0.895	0.895	AMGO1_RAT Amphoterin-induced protein 1 OS=Rattus norvegicus OX=10116 GN=Amigo1 PE=1 SV=1
2	Q80ZD8	0.0	870	492	0.895	0.896	AMGO1_MOUSE Amphoterin-induced protein 1 OS=Mus musculus OX=10090 GN=Amigo1 PE=1 SV=1
3	Q86WK6	0.0	1016	493	1.000	1.000	AMGO1_HUMAN Amphoterin-induced protein 1 OS=Homo sapiens OX=9606 GN=AMIGO1 PE=1 SV=1
4	Q80ZD9	2.79e-109	336	519	0.420	0.399	AMGO2_MOUSE Amphoterin-induced protein 2 OS=Mus musculus OX=10090 GN=Amigo2 PE=1 SV=1
5	Q7TNJ4	8.70e-104	322	520	0.416	0.394	AMGO2_RAT Amphoterin-induced protein 2 OS=Rattus norvegicus OX=10116 GN=Amigo2 PE=1 SV=1
6	F1N348	1.13e-102	319	521	0.406	0.384	F1N348_BOVIN Adhesion molecule with Ig like domain 2 OS=Bos taurus OX=9913 GN=AMIGO2 PE=3 SV=2
7	Q86SJ2	4.51e-102	317	522	0.414	0.391	AMGO2_HUMAN Amphoterin-induced protein 2 OS=Homo sapiens OX=9606 GN=AMIGO2 PE=1 SV=1
8	Q8C2S7	9.80e-76	248	508	0.361	0.350	AMGO3_MOUSE Amphoterin-induced protein 3 OS=Mus musculus OX=10090 GN=Amigo3 PE=1 SV=1
9	Q80ZD5	1.33e-65	222	508	0.339	0.329	AMGO3_RAT Amphoterin-induced protein 3 OS=Rattus norvegicus OX=10116 GN=Amigo3 PE=1 SV=1
10	Q8BXA0	4.51e-23	105	719	0.223	0.153	LRFN5_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Mus musculus OX=10090 GN=Lrfn5 PE=1 SV=1
11	D4A1J9	1.24e-22	103	719	0.221	0.152	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
12	D2XV92	3.38e-22	103	1513	0.156	0.051	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
13	Q96NI6	5.25e-22	102	719	0.221	0.152	LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Homo sapiens OX=9606 GN=LRFN5 PE=1 SV=2
14	Q9VZZ4	1.89e-21	100	1527	0.176	0.057	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
15	F1RCV3	1.31e-20	98.2	1516	0.148	0.048	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
16	O75094	8.74e-19	92.4	1523	0.158	0.051	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
17	Q3UQ28	2.33e-18	91.3	1475	0.197	0.066	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
18	O88280	2.46e-18	90.9	1523	0.142	0.046	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
19	Q9WVB4	6.17e-18	89.7	1523	0.140	0.045	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
20	Q92626	1.01e-17	89.0	1479	0.207	0.069	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.018	26.4	Immunoglobulin I-set domain
2	PF00047 ig	0.7	21.4	Immunoglobulin domain
3	PF13895 Ig_2	18	17.0	Immunoglobulin domain
4	PF13927 Ig_3	0.47	22.4	Immunoglobulin domain
5	PF18452 Ig_6	1.6e+02	13.6	Immunoglobulin domain
6	PF16706 Izumo-Ig	8.6	17.7	Izumo-like Immunoglobulin domain
7	PF00560 LRR_1	1.7e+02	14.2	Leucine Rich Repeat
8	PF12799 LRR_4	3.9e-11	54.2	Leucine Rich repeats (2 copies)
9	PF13306 LRR_5	0.73	21.2	BspA type Leucine rich repeat region (6 copies)
10	PF13855 LRR_8	1.1e-19	81.3	Leucine rich repeat
11	PF14580 LRR_9	0.17	22.9	Leucine-rich repeat
12	PF07686 V-set	0.063	24.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003508

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008494	0.712	Potassium voltage-gated channel, Shab-related subfamily, member 1
2	61853.ENSNLEP00000012313	0.603	Glucocorticoid modulatory element binding protein 2
3	61853.ENSNLEP00000013693	0.603	Trypsin domain containing 1
4	61853.ENSNLEP00000001507	0.564	Potassium voltage-gated channel, Shab-related subfamily, member 2
5	61853.ENSNLEP00000009100	0.559	Fli-1 proto-oncogene, ETS transcription factor
6	61853.ENSNLEP00000015629	0.520	Homer homolog 1 (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0051240	0.979	positive regulation of multicellular organismal process
GO:0051094	0.979	positive regulation of developmental process
GO:2000026	0.976	regulation of multicellular organismal development
GO:1904064	0.973	positive regulation of cation transmembrane transport
GO:0051962	0.969	positive regulation of nervous system development
GO:1901379	0.969	regulation of potassium ion transmembrane transport
GO:0009987	0.965	cellular process
GO:0051128	0.962	regulation of cellular component organization
GO:0043268	0.951	positive regulation of potassium ion transport
GO:1901381	0.915	positive regulation of potassium ion transmembrane transport
GO:0051130	0.866	positive regulation of cellular component organization
GO:0051963	0.695	regulation of synapse assembly
GO:0032501	0.633	multicellular organismal process
GO:1901890	0.632	positive regulation of cell junction assembly
GO:0051965	0.600	positive regulation of synapse assembly
GO:0032414	0.527	positive regulation of ion transmembrane transporter activity
GO:0032502	0.445	developmental process
GO:0048856	0.434	anatomical structure development
GO:0071840	0.391	cellular component organization or biogenesis
GO:0051179	0.383	localization
GO:0016043	0.362	cellular component organization
GO:0051234	0.347	establishment of localization
GO:0050896	0.341	response to stimulus
GO:0007275	0.321	multicellular organism development
GO:0048731	0.301	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.992	protein-containing complex
GO:0098797	0.927	plasma membrane protein complex
GO:0034703	0.915	cation channel complex
GO:0008076	0.909	voltage-gated potassium channel complex
GO:0036477	0.874	somatodendritic compartment
GO:0042995	0.869	cell projection
GO:0120025	0.794	plasma membrane bounded cell projection
GO:0044297	0.792	cell body
GO:0043005	0.771	neuron projection
GO:0043226	0.683	organelle
GO:0005622	0.666	intracellular anatomical structure
GO:0043025	0.655	neuronal cell body
GO:0043229	0.638	intracellular organelle
GO:0005737	0.634	cytoplasm
GO:0043231	0.626	intracellular membrane-bounded organelle
GO:0030424	0.336	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]